| PDBID: | 9qqj | | Status: | HPUB -- hold until publication | | Title: | ERK2 with an inhibitor | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-04-01 |
|
| PDBID: | 9qql | | Status: | HPUB -- hold until publication | | Title: | Mouse RPS15 P131 Mutant Ribosome POST translocation state | | Authors: | Santo, P.E., Astier, A., Plisson-Chastang, C. | | Deposition date: | 2025-04-01 |
|
| PDBID: | 9qqp | | Status: | HPUB -- hold until publication | | Title: | Mouse Ribosome rotated-2 PRE state | | Authors: | Santo, P.E., Astier, A., Plisson-Chastang, C. | | Deposition date: | 2025-04-01 |
|
| PDBID: | 9ua5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | RABV G binding with CTB011 Fab and CTB012 Fab | | Authors: | Cao, L., Zhang, C. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9nzc | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AfNth1:Tg-DNA duplex complex in a pre-intermediate state | | Authors: | Syed, A., Arvai, A.S., Tsai, C.L., Tainer, J.A. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9qqc | | Status: | HPUB -- hold until publication | | Title: | Acoustofluidic Sample Delivery System for Serial Crystallography, Thaumatin with acoustic ON | | Authors: | Bjelcic, M., Sellberg, J., Rajendran, K.V., Casadei, C., Viklund, T.E. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9qqg | | Status: | HPUB -- hold until publication | | Title: | Acoustofluidic Sample Delivery System for Serial Crystallography, Thaumatin with acoustic OFF | | Authors: | Bjelcic, M., Sellberg, J., Rajendran, K.V., Casadei, C., Viklund, T.E. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9qpi | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase in complex with Fe and ACV | | Authors: | Rabe, P., Schofield, C.J., Stead, A. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qpj | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase in complex with Fe and IPN using tr-SSX | | Authors: | Rabe, P., Schofield, C.J., Stead, A. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qpd | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qph | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase in complex with Fe and IPN using tr-SFX | | Authors: | Rabe, P., Schofield, C.J., Stead, A. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qpg | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase in complex with Fe and IPN | | Authors: | Rabe, P., Schofield, C.J. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qpl | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with an inhibitor | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9nxt | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Crystal Structure of Glutathione S-Transferase Per a 21 | | Authors: | Zong, G., Pedersen, L.C., Mueller, G.A. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9nxw | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Glutathione S-Transferase Bla g 22 | | Authors: | Zong, G., Pedersen, L.C., Mueller, G.A. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9nxu | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Crystal Structure of Glutathione S-Transferase Per a 22 | | Authors: | Zong, G., Pedersen, L.C., Mueller, G.A. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qoh | | Status: | HPUB -- hold until publication | | Title: | Mouse Ribosome POST translocation state | | Authors: | Santo, P.E., Astier, A., Plisson-Chastang, C. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qoy | | Status: | HPUB -- hold until publication | | Title: | Pseudomonas aeruginosa APH(3"")-IIb - Wild Type | | Authors: | Kowalewski, J., Tomaszczyk, M., Guichou, J.F., Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qov | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of [2Fe-2S]b D4A-FNR of A. fischeri | | Authors: | Volbeda, A., Fontecilla-Camps, J.C., Rohac, R. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qoe | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-Id with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qoc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qod | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-26 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMRTYTFDQVEKAIEQLYPDFTINTIEISGEGNDCIAYEINRDFIFKFPKHSRGSTNLFNEVNILKRIHNKLPLPIPEVVFTGMPSETYQMSFAGFTKIKGVPLTPLLLNNLPKQSQNQAAKDLARFLSELHSINISGFKSNLVLDFREKINEDNKKIKKLLSRELKGPQMKKVDDFYRDILENEIYFKYYPCLIHNDFSSDHILFDTEKNTICGIIDFGDAAISDPDNDFISLMEDDEEYGMEFVSKILNHYKHKDIPTVLEKYRMKEKYWSFEKIIYGKEYGYMDWYEEGLNEIRSIKIK
|
|
| PDBID: | 9qoi | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | APH(2'''')-IVa with an inhibitor | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalemski, J., Lionne, C. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qoz | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with an inhibitor | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qp3 | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with an inhibitor | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-26 |
|
