Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9nkx
Status:AUTH -- processed, waiting for author review and approval
Title:[TT-5x_Ag4] Tensegrity triangle structure with a T:T base pair hosting a templated 4-atom silver nanocluster
Authors:Vecchioni, S., Perren, L., Sha, R., Ohayon, Y.P.
Deposition date:2025-03-01
PDBID:9nkw
Status:AUTH -- processed, waiting for author review and approval
Title:[UU-5x_Ag4] Tensegrity triangle structure with a U:U base pair hosting a templated 4-atom silver nanocluster
Authors:Vecchioni, S., Perren, L., Sha, R., Ohayon, Y.P.
Deposition date:2025-03-01
PDBID:9nkt
Status:AUTH -- processed, waiting for author review and approval
Title:[0,8,12P-->13] Shifted tensegrity triangle with an (arm,center,arm) distribution of (0,8,12) base pairs, 1 nt sticky ends, and 5'' phosphates containing a semi-junction that becomes left-handed
Authors:Horvath, A., Vecchioni, S., Woloszyn, K., Ohayon, Y.P., Sha, R.
Deposition date:2025-03-01
PDBID:9qb9
Status:HPUB -- hold until publication
Title:CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with a heparin-derived trisaccharide and the ATP-competitive inhibitor 4w
Authors:Werner, C., Harasimowicz, H., Weiss, M.S., Niefind, K.
Deposition date:2025-03-01
PDBID:9njz
Status:AUTH -- processed, waiting for author review and approval
Title:[0,8,12-1] Shifted tensegrity triangle with an (arm,center,arm) distribution of (0,8,12) base pairs and 1 nt sticky ends
Authors:Horvath, A., Vecchioni, S., Woloszyn, K., Ohayon, Y.P., Sha, R.
Deposition date:2025-02-28
PDBID:9qal
Status:AUTH -- processed, waiting for author review and approval
Title:Solution NMR structure of Arkadia 2 RING domain
Authors:Marousis, K.D., Giannari, D., Seliami, A., Politi, M., Birkou, M., Bentrop, D., Episkopou, V., Spyroulias, G.A.
Deposition date:2025-02-28
PDBID:9m2l
Status:HPUB -- hold until publication
Title:Crystal structure of okaE in complex with a-ketoglutarate and okaramine A at 2.5 angstroms resolution.
Authors:Liu, T.H., Yan, W.P.
Deposition date:2025-02-27
PDBID:9m2a
Status:HPUB -- hold until publication
Title:The crystal structure of the trypanosome alternative oxidase complexed with a trypanocidal phosphonium derivative (compound1)
Authors:Ebiloma, G.U., Balogun, E.O., Dardonville, C., De Koning, H.P., Shiba, T.
Deposition date:2025-02-27
PDBID:9nin
Status:HPUB -- hold until publication
Title:The structure of human Vacuolar Protein Sorting 34 catalytic domain bound to RD-I-86
Authors:Cartwright, J.J., Abiodun, W.O., Dass, R., Singleton, J.D., Doukov, T., Peterson, M.A., Moody, J.D.
Deposition date:2025-02-26
PDBID:9niw
Status:HPUB -- hold until publication
Title:Fab1550 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein
Authors:Moskovitz, R., Wilson, I.A.
Deposition date:2025-02-26
PDBID:9niy
Status:HPUB -- hold until publication
Title:Fab1393 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein
Authors:Moskovitz, R., Wilson, I.A.
Deposition date:2025-02-26
PDBID:9nj4
Status:HPUB -- hold until publication
Title:Fab1437 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein
Authors:Moskovitz, R., Wilson, I.A.
Deposition date:2025-02-26
PDBID:9q9t
Status:HPUB -- hold until publication
Title:Human ROCK2 in complex with a dihydropyrazolo-pyrimidine inhibitor
Authors:Pala, D., Clark, D., Accetta, A., Rancati, F., Edwards, C.
Deposition date:2025-02-26
Sequence:

>Entity 1


GAAGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFPALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMDETGMVHCDTAVGTPDYISPEVLKSQGGDGFYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIRQHPFFKNDQWHWDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYR
PDBID:9m1x
Status:HPUB -- hold until publication
Title:X-ray structure of human heart fatty acid-binding protein at 0.80 A resolution (holo-FABP3)
Authors:Sugiyama, S., Maekawa, S., Matsuoka, S., Murata, M.
Deposition date:2025-02-26
PDBID:9ni2
Status:HPUB -- hold until publication
Title:Fab369 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein
Authors:Moskovitz, R., Wilson, I.A.
Deposition date:2025-02-25
PDBID:9nhy
Status:HPUB -- hold until publication
Title:Fab1502 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein
Authors:Moskovitz, R., Wilson, I.A.
Deposition date:2025-02-25
PDBID:9ni1
Status:HPUB -- hold until publication
Title:Fab389 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein
Authors:Moskovitz, R., Wilson, I.A.
Deposition date:2025-02-25
PDBID:9q8o
Status:HPUB -- hold until publication
Title:Crystal structure of Hsp82-MD in complex with the CS domain of Sgt1
Authors:Lopez, A., Napolitano, V., Delhommel, F., Popowicz, G.M., Sattler, M.
Deposition date:2025-02-25
PDBID:9q8r
Status:HPUB -- hold until publication
Title:Human ROCK1 in complex with a dihydropyrazolo-pyrimidine inhibitor
Authors:Pala, D., Clark, D., Accetta, A., Rancati, F., Edwards, C.
Deposition date:2025-02-25
Sequence:

>Entity 1


GASFETRFEKMDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYKDTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTAEVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFPDDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLSSDIDTSNFDDLEEDKGEEETFPIPKAFVGNQLPFVGFTYYSNRRY
PDBID:9q8t
Status:HPUB -- hold until publication
Title:Nociceptive properties of U5-theraphotoxin-Hs1b, a novel peptide from the Cyriopagopus schmidti spider, active on NaV1.7 channel
Authors:Meudal, H., Landon, C.
Deposition date:2025-02-25
PDBID:9q8x
Status:HPUB -- hold until publication
Title:Ku70/80 bound to a 153 bp H2AX nucleosome
Authors:Hall, C., Chaplin, A.K.
Deposition date:2025-02-25
PDBID:9q8p
Status:HPUB -- hold until publication
Title:Structure characterization and anticancer potential of the fungal immunomodulatory protein FIP-ach
Authors:Wszolek, A., Patel, S.N., Dubin, G.
Deposition date:2025-02-25
PDBID:9q8u
Status:HPUB -- hold until publication
Title:Complex of Caprine Serum Albumin with Cefaclor
Authors:Duszynski, K., Talaj, J.A., Bujacz, A., Bujacz, G.
Deposition date:2025-02-25
Sequence:

>Entity 1


DTHKSEIAHRFNDLGEENFQGLVLIAFSQYLQQCPFDEHVKLVKELTEFAKTCVADESHAGCDKSLHTLFGDELCKVATLRETYGDMADCCEKQEPERNECFLKHKDDSPDLPKLKPEPDTLCAEFKADEKKFWGKYLYEVARRHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPKIETMREKVLASSARQRLRCASIQKFGERALKAWSVARLSQKFPKADFTDVTKIVTDLTKVHKECCHGDLLECADDRADLAKYICDHQDTLSSKLKECCDKPVLEKSHCIAEIDKDAVPENLPPLTADFAEDKEVCKNYQEAKDVFLGSFLYEYSRRHPEYAVSVLLRLAKEYEATLEDCCAKEDPHACYATVFDKLKHLVDEPQNLIKKNCELFEKHGEYGFQNALIVRYTRKAPQVSTPTLVEISRSLGKVGTKCCAKPESERMPCTEDYLSLILNRLCVLHEKTPVSAKVTKCCTESLVNRRPCFSDLTLDETYVPKPFDGESFTFHADICTLPDTEKQIKKQTALVELLKHKPKATDEQLKTVMENFVAFVDKCCAADDKEGCFLLEGPKLVASTQAALA
PDBID:9q8m
Status:HPUB -- hold until publication
Title:VPS35-VPS26-SNX12 Complex
Authors:Pardo, M., Rojas, A.L., Hierro, A.
Deposition date:2025-02-25
PDBID:9m0m
Status:HPUB -- hold until publication
Title:Crystal structure of a thermophilic family II inorganic pyrophosphatase in Thermodesulfobacterium commune
Authors:Maruoka, S., Teramoto, T., Watanabe, K., Kakuta, Y.
Deposition date:2025-02-25

238582

數據於2025-07-09公開中

PDB statisticsPDBj update infoContact PDBjnumon