PDBID: | 8kf1 | Status: | HPUB -- hold until publication | Title: | The cryo-EM structure of AV-45 bound type1 amyloid beta 42 fibril. | Authors: | Zhao, Q.Y., Tao, Y.Q., Liu, C., Li, D. | Deposition date: | 2023-08-15 |
|
PDBID: | 8kf3 | Status: | HPUB -- hold until publication | Title: | The cryo-EM structure of type3 amyloid beta 42 fibril. | Authors: | Zhao, Q.Y., Tao, Y.Q., Liu, C., Li, D. | Deposition date: | 2023-08-15 |
|
PDBID: | 8kf6 | Status: | HPUB -- hold until publication | Title: | The cryo-EM structure of AV-45 bound type3 amyloid beta 42 fibril. | Authors: | Zhao, Q.Y., Tao, Y.Q., Liu, C., Li, D. | Deposition date: | 2023-08-15 |
|
PDBID: | 8kf4 | Status: | HPUB -- hold until publication | Title: | The cryo-EM structure of type1 amyloid beta 42 fibril in AD2 patient. | Authors: | Zhao, Q.Y., Tao, Y.Q., Liu, C., Li, D. | Deposition date: | 2023-08-15 |
|
PDBID: | 8kf5 | Status: | HPUB -- hold until publication | Title: | The cryo-EM structure of type1 amyloid beta 42 fibril in AD3. | Authors: | Zhao, Q.Y., Tao, Y.Q., Liu, C., Li, D. | Deposition date: | 2023-08-15 |
|
PDBID: | 8q6l | Status: | HPUB -- hold until publication | Title: | human Carbonic Anhydrase I in complex with 3,4-dihydro-1H-benzo[c][1,2]oxaborinin-1-ol | Authors: | Angeli, A., Ferraroni, M. | Deposition date: | 2023-08-13 | Sequence: | >Entity 1 MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
PDBID: | 8kew | Status: | HPUB -- hold until publication | Title: | The cryo-EM structure of type1 amyloid beta 42 fibril. | Authors: | Zhao, Q.Y., Tao, Y.Q., Liu, C., Li, D. | Deposition date: | 2023-08-13 |
|
PDBID: | 8tt8 | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | Joint Xray/Neutron structure of Macrophage Migration Inhibitory Factor (MIF) Bound to 4-hydroxyphenylpyruvate at room temperature | Authors: | Schroder, G.C., Meilleur, F., Crichlow, G.V., Lolis, E.J. | Deposition date: | 2023-08-13 |
|
PDBID: | 8tt9 | Status: | HPUB -- hold until publication | Title: | X-ray structure of Macrophage Migration Inhibitory Factor (MIF) Covalently Bound to 4-hydroxyphenylpyruvate (HPP) | Authors: | Schroder, G.C., Meilleur, F., Nix, J.C., Crichlow, G.V., Lolis, E.J. | Deposition date: | 2023-08-13 | Sequence: | >Entity 1 PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
|
|
PDBID: | 8q6d | Status: | HPUB -- hold until publication | Title: | Anaerobic crystal structure of HIF prolyl hydroxylase 2 (PHD2 181-407) in complex with HIF2alpha-CODD peptide (523-542), Fe(II) and 2-oxoglutarate (2OG) | Authors: | Fiorini, G., Figg Jr, W.D., Schofield, C.J. | Deposition date: | 2023-08-11 |
|
PDBID: | 8q6e | Status: | HPUB -- hold until publication | Title: | Aerobic crystal structure of HIF prolyl hydroxylase 2 (PHD2 181-407) in complex with Fe(III), 2-oxoglutarate (2OG) and HIF2alpha-CODD peptide | Authors: | Fiorini, G., Figg Jr, W.D., Schofield, C.J. | Deposition date: | 2023-08-11 |
|
PDBID: | 7gau | Status: | HPUB -- hold until publication | Title: | PanDDA analysis group deposition of ground-state model of MAP1LC3B | Authors: | Kumar, A., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von-Delft, F., Knapp, S., Structural Genomics Consortium (SGC) | Deposition date: | 2023-08-11 |
|
PDBID: | 8q64 | Status: | HPUB -- hold until publication | Title: | Crystal structure of hydroxylated HIF2alpha-CODD peptide (523-542) bound to apo-HIF prolyl hydroxylase 2 (PHD2 181-407) | Authors: | Fiorini, G., Figg Jr, W.D., Schofield, C.J. | Deposition date: | 2023-08-10 |
|
PDBID: | 7gaa | Status: | HPUB -- hold until publication | Title: | PanDDA analysis group deposition -- Crystal Structure of MAP1LC3B in complex with Z1198233191 | Authors: | Kumar, A., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von-Delft, F., Knapp, S., Structural Genomics Consortium (SGC) | Deposition date: | 2023-08-10 |
|
PDBID: | 7gab | Status: | HPUB -- hold until publication | Title: | PanDDA analysis group deposition -- Crystal Structure of MAP1LC3B in complex with Z1255402624 | Authors: | Kumar, A., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von-Delft, F., Knapp, S., Structural Genomics Consortium (SGC) | Deposition date: | 2023-08-10 |
|
PDBID: | 7gac | Status: | HPUB -- hold until publication | Title: | PanDDA analysis group deposition -- Crystal Structure of MAP1LC3B in complex with Z1456069604 | Authors: | Kumar, A., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von-Delft, F., Knapp, S., Structural Genomics Consortium (SGC) | Deposition date: | 2023-08-10 |
|
PDBID: | 7gad | Status: | HPUB -- hold until publication | Title: | PanDDA analysis group deposition -- Crystal Structure of MAP1LC3B in complex with Z1667545918 | Authors: | Kumar, A., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von-Delft, F., Knapp, S., Structural Genomics Consortium (SGC) | Deposition date: | 2023-08-10 |
|
PDBID: | 7gae | Status: | HPUB -- hold until publication | Title: | PanDDA analysis group deposition -- Crystal Structure of MAP1LC3B in complex with Z1688504114 | Authors: | Kumar, A., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von-Delft, F., Knapp, S., Structural Genomics Consortium (SGC) | Deposition date: | 2023-08-10 |
|
PDBID: | 7gaf | Status: | HPUB -- hold until publication | Title: | PanDDA analysis group deposition -- Crystal Structure of MAP1LC3B in complex with Z183352334 | Authors: | Kumar, A., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von-Delft, F., Knapp, S., Structural Genomics Consortium (SGC) | Deposition date: | 2023-08-10 |
|
PDBID: | 7gag | Status: | HPUB -- hold until publication | Title: | PanDDA analysis group deposition -- Crystal Structure of MAP1LC3B in complex with Z198195770 | Authors: | Kumar, A., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von-Delft, F., Knapp, S., Structural Genomics Consortium (SGC) | Deposition date: | 2023-08-10 |
|
PDBID: | 7gah | Status: | HPUB -- hold until publication | Title: | PanDDA analysis group deposition -- Crystal Structure of MAP1LC3B in complex with Z2033637875 | Authors: | Kumar, A., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von-Delft, F., Knapp, S., Structural Genomics Consortium (SGC) | Deposition date: | 2023-08-10 |
|
PDBID: | 7gai | Status: | HPUB -- hold until publication | Title: | PanDDA analysis group deposition -- Crystal Structure of MAP1LC3B in complex with Z212122838 | Authors: | Kumar, A., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von-Delft, F., Knapp, S., Structural Genomics Consortium (SGC) | Deposition date: | 2023-08-10 |
|
PDBID: | 7gaj | Status: | HPUB -- hold until publication | Title: | PanDDA analysis group deposition -- Crystal Structure of MAP1LC3B in complex with Z285233820 | Authors: | Kumar, A., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von-Delft, F., Knapp, S., Structural Genomics Consortium (SGC) | Deposition date: | 2023-08-10 |
|
PDBID: | 7gak | Status: | HPUB -- hold until publication | Title: | PanDDA analysis group deposition -- Crystal Structure of MAP1LC3B in complex with Z287121492 | Authors: | Kumar, A., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von-Delft, F., Knapp, S., Structural Genomics Consortium (SGC) | Deposition date: | 2023-08-10 |
|
PDBID: | 7gal | Status: | HPUB -- hold until publication | Title: | PanDDA analysis group deposition -- Crystal Structure of MAP1LC3B in complex with Z291279160 | Authors: | Kumar, A., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von-Delft, F., Knapp, S., Structural Genomics Consortium (SGC) | Deposition date: | 2023-08-10 |
|