| PDBID: | 9yl9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of apo HrmI from Streptomyces griseoflavus | | Authors: | Pope, S.R., Boal, A.K. | | Deposition date: | 2025-10-08 |
|
| PDBID: | 9yl8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Ni(II)-bound SeMet-HrmI from Streptomyces griseoflavus | | Authors: | Pope, S.R., Boal, A.K. | | Deposition date: | 2025-10-08 |
|
| PDBID: | 9ylc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of reduced as-isolated Fe(II)Fe(II) Streptomyces griseoflavus HrmI | | Authors: | Pope, S.R., Boal, A.K. | | Deposition date: | 2025-10-08 |
|
| PDBID: | 9yla | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Fe(II)-soaked apo HrmI from Streptomyces griseoflavus | | Authors: | Pope, S.R., Boal, A.K. | | Deposition date: | 2025-10-08 |
|
| PDBID: | 9ylg | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of as-isolated Fe(III)Fe(III) Streptomyces griseoflavus HrmI in complex with L-lysine | | Authors: | Pope, S.R., Boal, A.K. | | Deposition date: | 2025-10-08 |
|
| PDBID: | 9yld | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of reduced as-isolated Fe(II)Fe(II) Streptomyces griseoflavus HrmI in complex with L-lysine | | Authors: | Pope, S.R., Boal, A.K. | | Deposition date: | 2025-10-08 |
|
| PDBID: | 9yl2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human Methionine Adenosyltransferase 2A in complex with ddhATP | | Authors: | Sagatova, A.A., Shin, J.K., Lee, J.H., Wood, J.M., Sidoli, S., Lachowicz, J.L., Harris, L.D., Grove, T.L. | | Deposition date: | 2025-10-08 |
|
| PDBID: | 9yl6 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of as-isolated Fe(III)Fe(III) Streptomyces griseoflavus HrmI | | Authors: | Pope, S.R., Boal, A.K. | | Deposition date: | 2025-10-08 |
|
| PDBID: | 9sx9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Vibrio cholerae competence pilus | | Authors: | Maggi, S., Kreida, S., Yang, L., Teipen, A.E., Lynch, D.L., Dalia, A.B., Gumbart, J.C., Jensen, G.J. | | Deposition date: | 2025-10-08 | | Release date: | 2026-10-08 |
|
| PDBID: | 9sx6 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CryoEM structure of the octamer MraZ in complex with 1 box promoter from Mycoplasma genitalium | | Authors: | Reverter, D., Sanchez-Alba, L., Durand, A. | | Deposition date: | 2025-10-08 | | Release date: | 2026-10-08 |
|
| PDBID: | 9sx4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human fumarylacetoacetate hydrolase (FAH) in complex with HT1.6 | | Authors: | Scarin, R., Rojas, A.L., Millet, O. | | Deposition date: | 2025-10-08 |
|
| PDBID: | 9x2r | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of a GRAS protein heterodimer complex | | Authors: | Wan, L.H., Hu, Y.X. | | Deposition date: | 2025-10-07 |
|
| PDBID: | 9ykr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the GLP (EHMT1) SET domain in complex with SAM and TNG917 | | Authors: | Whittington, D.A. | | Deposition date: | 2025-10-07 |
|
| PDBID: | 9yks | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the G9a (EHMT2) SET domain in complex with SAM and TNG917 | | Authors: | Whittington, D.A. | | Deposition date: | 2025-10-07 |
|
| PDBID: | 9swu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NcBBE14 | | Authors: | Bijelic, A., Baldauf, S., Macheroux, P. | | Deposition date: | 2025-10-07 |
|
| PDBID: | 9yk1 | | Status: | HPUB -- hold until publication | | Title: | Room-temperature X-ray structure of D132N Bacillus halodurans RNase H1 in complex with RNA/DNA duplex | | Authors: | Kovalevsky, A., Gerlits, O. | | Deposition date: | 2025-10-06 | | Sequence: | >Entity 1
SAKEEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYGRK
>Entity 2
UCGACA
>Entity 3
(DA)(DT)(DG)(DT)(DC)(DG)
|
|
| PDBID: | 9yk3 | | Status: | HPUB -- hold until publication | | Title: | Room-temperature X-ray structure of D132N Bacillus halodurans RNase H1 in complex with complementary RNA/DNA duplex | | Authors: | Kovalevsky, A., Gerlits, O. | | Deposition date: | 2025-10-06 | | Sequence: | >Entity 1
SAKEEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYGRK
>Entity 2
CGACAU
>Entity 3
(DA)(DT)(DG)(DT)(DC)(DG)
|
|
| PDBID: | 9yk5 | | Status: | HPUB -- hold until publication | | Title: | 100K X-ray structure of mixed metal D132N Bacillus halodurans RNase H1 complex with RNA/DNA duplex | | Authors: | Kovalevsky, A., Gerlits, O. | | Deposition date: | 2025-10-06 | | Sequence: | >Entity 1
SAKEEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYGRK
>Entity 2
UCGACA
>Entity 3
(DA)(DT)(DG)(DT)(DC)(DG)
|
|
| PDBID: | 9yk6 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of anti-HCV human neutralizing antibody K595 | | Authors: | Nguyen, T.K.Y., Wilson, I.A. | | Deposition date: | 2025-10-06 |
|
| PDBID: | 9ykd | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of anti-HCV human neutralizing antibody K569 | | Authors: | Nguyen, T.K.Y., Wilson, I.A. | | Deposition date: | 2025-10-06 |
|
| PDBID: | 9yjw | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Transferrin Binding Protein A | | Authors: | Dubey, S., Noinaj, N. | | Deposition date: | 2025-10-05 |
|
| PDBID: | 9swc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Hen egg-white lysozyme structure in LCP medium collected via the Round-Chip method | | Authors: | Zabelskii, D., Round, A. | | Deposition date: | 2025-10-05 | | Release date: | 2026-10-05 |
|
| PDBID: | 9sw4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the MvhAGD-HdrABC dimer of M. marburgensis under state 1 substate a (composite structure) | | Authors: | San Segundo-Acosta, P., Murphy, B.J. | | Deposition date: | 2025-10-04 |
|
| PDBID: | 9sw2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the MvhAGD-HdrABC dimer of M. marburgensis under state 2 substate a (composite structure) | | Authors: | San Segundo-Acosta, P., Murphy, B.J. | | Deposition date: | 2025-10-04 |
|
| PDBID: | 9sw1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human fumarylacetoacetate hydrolase (FAH) in complex with A4 | | Authors: | Scarin, R., Rojas, A.L., Millet, O. | | Deposition date: | 2025-10-04 |
|
