Loading
PDBj
MenuPDBj@FacebookPDBj@TwitterPDBj@YouTubewwPDB FoundationwwPDB
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:8pwk
Status:HPUB -- hold until publication
Title:human HINT1 in complex with compound AT8003
Authors:Zimberger, C., Canard, B., Ferron, F.
Deposition date:2023-07-20
PDBID:8tio
Status:HPUB -- hold until publication
Title:Human ACKR3 with C tail extended by 12 glycines phosphorylated by GRK5 in complex with Arrestin2 reconstructed without receptor/micelle
Authors:Chen, Q., Tesmer, J.J.G.
Deposition date:2023-07-19
Release date:2025-01-22
PDBID:8pvy
Status:HPUB -- hold until publication
Title:Cryo-EM structure of the human BRISC dimer complex bound to compound FX-171-C
Authors:Chandler, F., Zeqiraj, E.
Deposition date:2023-07-18
Release date:2025-01-18
PDBID:8pvq
Status:HPUB -- hold until publication
Title:Crystal Structure of Human PTX3 C-terminal domain
Authors:Levy, C.W.
Deposition date:2023-07-18
PDBID:8k48
Status:HPUB -- hold until publication
Title:LTD of arabidopsis thaliana
Authors:Wang, C., Xu, X.M.
Deposition date:2023-07-17
PDBID:8ptv
Status:HPUB -- hold until publication
Title:IPNS variant N252Q in complex with Fe and ACV under anaerobic conditions
Authors:Rabe, P., Schofield, C.J.
Deposition date:2023-07-15
PDBID:8pts
Status:HPUB -- hold until publication
Title:human GUK1 in complex with compound AT8001
Authors:Zimberger, C., Canard, B., Ferron, F.
Deposition date:2023-07-14
Sequence:

>Entity 1


MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA
PDBID:8k32
Status:HPUB -- hold until publication
Title:The complex structure of SLKARI with NADH at 2.12-angstrom resolution
Authors:Chen, C.Y., Huang, C.H.
Deposition date:2023-07-14
PDBID:8pru
Status:WAIT -- processing started, waiting for author input to continue processing
Title:Engineered form of T thermophiles AHIR
Authors:Roberts, M., Powell, A., Lewis, C., Sinclair, J.
Deposition date:2023-07-12
PDBID:8tga
Status:HPUB -- hold until publication
Title:Complex of NPR1 ectodomain and REGN5381 Fab in an active-like state with no ANP bound
Authors:Franklin, M.C., Romero Hernandez, A.
Deposition date:2023-07-12
PDBID:8tg0
Status:HPUB -- hold until publication
Title:Solution NMR structure of the cold shock domain of the Arabidopsis thaliana glycine-rich protein AtGRP2
Authors:Pougy, K.C., Almeida, F.C.L., Pinheiro, A.S.
Deposition date:2023-07-12
Release date:2025-01-12
PDBID:8tft
Status:HPUB -- hold until publication
Title:Fab of O13-1 human IgG1 antibody bound to IgV domain of human TIM-3
Authors:Oganesyan, V.Y., van Dyk, N., Mazor, Y., Yang, C.
Deposition date:2023-07-11
PDBID:8jzp
Status:HOLD -- hold until a certain date
Title:Structure of mouse C5a-human C5aR1-Go complex
Authors:Yadav, M.K., Yadav, R., Maharana, J., Sarma, P., Banerjee, R., Shukla, A.K., Gati, C.
Deposition date:2023-07-06
Release date:2025-01-06
PDBID:8tck
Status:HPUB -- hold until publication
Title:Apo crystal Structure of modified HIV reverse transcriptase p51 domain (FPC1)
Authors:Pedersen, L.C., London, R.E.
Deposition date:2023-07-02
PDBID:8tcm
Status:HPUB -- hold until publication
Title:Crystal Structure of modified HIV reverse transcriptase p51 domain (FPC1) with picric acid and Xanthene-1,3,6,8-tetrol bound
Authors:Pedersen, L.C., London, R.E.
Deposition date:2023-07-02
PDBID:8pnf
Status:HPUB -- hold until publication
Title:HRV B14 virion proteins
Authors:Gil-Cantero, D., Mata, C.P., Mateu, M.G., Caston, J.R.
Deposition date:2023-06-30
Release date:2024-12-30
PDBID:8tbc
Status:HPUB -- hold until publication
Title:Structure of a de novo designed interleukin-21 mimetic complex with IL-21R and IL-2Rg
Authors:Abhiraman, G.C., Jude, K.M., Garcia, K.C.
Deposition date:2023-06-28
Release date:2024-12-28
PDBID:8tbb
Status:HPUB -- hold until publication
Title:F9S, novel TIM-3 targeting antibody, bound to IgV domain of TIM-3
Authors:Oganesyan, V., van Dyk, N., Mazor, Y., Yang, C.
Deposition date:2023-06-28
PDBID:8tac
Status:HPUB -- hold until publication
Title:Designed DNA binding protein
Authors:Doyle, L., Stoddard, B.L., Glasscock, C.J., McHugh, R.P., Pecoraro, R.J.
Deposition date:2023-06-27
PDBID:8phm
Status:HPUB -- hold until publication
Title:Oxalate-bound cobalt(II) human carbonic anhydrase II
Authors:Gigli, L., Malanho Silva, J., Cerofolini, L., Macedo, A.L., Geraldes, C.F.G.C., Suturina, E.A., Calderone, V., Fragai, M., Parigi, G., Ravera, E., Luchinat, C.
Deposition date:2023-06-20
Release date:2024-12-20
Sequence:

>Entity 1


NWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
PDBID:8t68
Status:REPL -- author sent new coordinates, entry to be reprocessed
Title:Crystal Structure of the SET Domain of Human Histone-Lysine N-Methyltransferase SUV420H1 in complex with RQ3-111
Authors:Zeng, H., Dong, A., Brown, P.J., Arrowsmith, C.H., Edwards, A.M., Halabelian, L., Structural Genomics Consortium (SGC)
Deposition date:2023-06-15
PDBID:8jqi
Status:HPUB -- hold until publication
Title:Cryo EM map of full length PLC gamma 2 and FGFR1 Kinase Domain
Authors:Shin, Y.-C., Liao, M.
Deposition date:2023-06-14
Release date:2024-12-14
PDBID:8jq0
Status:HOLD -- hold until a certain date
Title:Crystal structure of ZBTB48 ZF10-11-C in complex with CIITA promoter
Authors:Li, F.D., Wang, S.M.
Deposition date:2023-06-13
Release date:2024-12-13
PDBID:8pa0
Status:WAIT -- processing started, waiting for author input to continue processing
Title:cvHsp (HspB7) C131S alpha-crystallin domain - filamin C (FLNC) domain 24 complex
Authors:Wang, Z., Benesch, J.L.P., Allison, T.M., Song, H., McDonough, M.A., Brem, J., Rabe, P.
Deposition date:2023-06-06
PDBID:8p9a
Status:AUTH -- processed, waiting for author review and approval
Title:80S yeast ribosome in complex with Methyllissoclimide
Authors:Terrosu, S., Yusupov, M., Vanderwal, C.
Deposition date:2023-06-05

222415

數據於2024-07-10公開中

PDB statisticsPDBj update infoContact PDBjnumon