| PDBID: | 9ufd | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of BA12-bound alpha-synuclein fibril polymorph 6A6B | | Authors: | Zhang, S.Q., Liu, C., Li, D. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9uff | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of BA21-bound alpha-synuclein fibril polymorph 6A6B | | Authors: | Zhang, S.Q., Liu, C., Li, D. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9ufl | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of BA22-bound alpha-synuclein fibril polymorph 6A6B | | Authors: | Zhang, S.Q., Liu, C., Li, D. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9ufs | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of BA23-bound alpha-synuclein fibril polymorph 6A6B | | Authors: | Zhang, S.Q., Liu, C., Li, D. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9ufx | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of HA11-bound alpha-synuclein fibril polymorph 6A6B | | Authors: | Zhang, S.Q., Liu, C., Li, D. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9o5p | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of ClpC1-NTD complexed with Diterpene B (GRDN0001) | | Authors: | Ratia, K., Lee, H., Abad-Zapatero, C. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9ufy | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of HA21-bound alpha-synuclein fibril polymorph 6A6B | | Authors: | Zhang, S.Q., Liu, C., Li, D. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9ug0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of HA31-bound alpha-synuclein fibril polymorph 6A6B | | Authors: | Zhang, S.Q., Liu, C., Li, D. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9ug1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of HA32-bound alpha-synuclein fibril polymorph 6A6B | | Authors: | Zhang, S.Q., Liu, C., Li, D. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9o5e | | Status: | HPUB -- hold until publication | | Title: | The dimeric KICSTOR-GATOR1 supercomplex | | Authors: | Bayly-Jones, C., Lupton, C.J., Chang, Y.G., Ellisdon, A.M. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9o5j | | Status: | HPUB -- hold until publication | | Title: | Human Aconitate Decarboxylase I apo form | | Authors: | Runge, B.R., Monteiro, D.C.F. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9o5d | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The KICSTOR-GATOR1-SAMTOR complex | | Authors: | Bayly-Jones, C., Lupton, C.J., Chang, Y.G., Ellisdon, A.M. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9o5n | | Status: | HPUB -- hold until publication | | Title: | Human Aconitate Decarboxylase I bound to citraconate | | Authors: | Runge, B.R., Monteiro, D.C.F. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9uew | | Status: | HPUB -- hold until publication | | Title: | Wild-type Bacillus megaterium Penicillin G Acylase with Non-Covalently Bound Phenylacetic Acid | | Authors: | Kaewsasan, C., Rojviriya, C., Yuvaniyama, J. | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9uey | | Status: | HPUB -- hold until publication | | Title: | CTP synthase PRE-state 1 | | Authors: | Guo, C.J. | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9uez | | Status: | HPUB -- hold until publication | | Title: | CTP synthase PRE-state 2 | | Authors: | Guo, C.J. | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9uf0 | | Status: | HPUB -- hold until publication | | Title: | CTP synthase PRE-state 3 | | Authors: | Guo, C.J. | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9uf1 | | Status: | HPUB -- hold until publication | | Title: | CTP synthase PRE-state 4 | | Authors: | Guo, C.J. | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9uf2 | | Status: | HPUB -- hold until publication | | Title: | CTP synthase PRE-state 5 | | Authors: | Guo, C.J. | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9uf3 | | Status: | HPUB -- hold until publication | | Title: | CTP synthase PRE-state 6 | | Authors: | Guo, C.J. | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9uf4 | | Status: | HPUB -- hold until publication | | Title: | CTP synthase PRE-state 7 | | Authors: | Guo, C.J. | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9uf5 | | Status: | HPUB -- hold until publication | | Title: | CTP synthase PRE-state 8 | | Authors: | Guo, C.J. | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9o4t | | Status: | HPUB -- hold until publication | | Title: | RT XFEL structure of Soybean Lipoxygenase-1 in large unit-cell | | Authors: | Wolff, A.M., Thompson, M.C. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9qt8 | | Status: | HPUB -- hold until publication | | Title: | Polyester Hydrolase Leipzig 7 (PHL7) variant R2M2-P155G | | Authors: | Useini, A., Strater, N., Kuenze, G., Sonnendecker, C. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9qtc | | Status: | HPUB -- hold until publication | | Title: | HINT1 complexed with GS-441524 | | Authors: | Zimberger, C., Ferron, F. | | Deposition date: | 2025-04-08 | | Sequence: | >Entity 1
MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG
|
|
