PDBID: | 7i26 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0030304-001 (A71EV2A-x2304) | Authors: | Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F. | Deposition date: | 2025-03-03 |
|
PDBID: | 7i27 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0018402-002 (A71EV2A-x2458) | Authors: | Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F. | Deposition date: | 2025-03-03 |
|
PDBID: | 9nla | Status: | AUTH -- processed, waiting for author review and approval | Title: | [CC-5x_Ag6] Tensegrity triangle structure with a C:C base pair hosting a templated 6-atom silver nanocluster | Authors: | Vecchioni, S., Perren, L., Sha, R., Ohayon, Y.P. | Deposition date: | 2025-03-02 |
|
PDBID: | 9qb9 | Status: | HPUB -- hold until publication | Title: | CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with a heparin-derived trisaccharide and the ATP-competitive inhibitor 4w | Authors: | Werner, C., Harasimowicz, H., Weiss, M.S., Niefind, K. | Deposition date: | 2025-03-01 |
|
PDBID: | 9nkv | Status: | AUTH -- processed, waiting for author review and approval | Title: | [CC-5x_Ag4] Tensegrity triangle structure with a C:C base pair hosting a templated 4-atom silver nanocluster | Authors: | Vecchioni, S., Perren, L., Sha, R., Ohayon, Y.P. | Deposition date: | 2025-03-01 |
|
PDBID: | 9qam | Status: | HPUB -- hold until publication | Title: | Human angiotensin-1 converting enzyme C-domain in complex with ciprofloxacin | Authors: | Gregory, K.S., Acharya, K.R. | Deposition date: | 2025-02-28 |
|
PDBID: | 9qab | Status: | HPUB -- hold until publication | Title: | CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment E11 and CX-4945 (Silmitasertib) | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | Deposition date: | 2025-02-28 |
|
PDBID: | 9qag | Status: | HPUB -- hold until publication | Title: | CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment FF08 and CX-4945 (Silmitasertib) | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | Deposition date: | 2025-02-28 |
|
PDBID: | 9qah | Status: | HPUB -- hold until publication | Title: | CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment G04 and CX-4945 (Silmitasertib) | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | Deposition date: | 2025-02-28 |
|
PDBID: | 9qb6 | Status: | HPUB -- hold until publication | Title: | CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment H02 and CX-4945 (Silmitasertib) | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | Deposition date: | 2025-02-28 |
|
PDBID: | 9qb0 | Status: | HPUB -- hold until publication | Title: | CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment H07 | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | Deposition date: | 2025-02-28 |
|
PDBID: | 9qak | Status: | HPUB -- hold until publication | Title: | CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment G07 | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | Deposition date: | 2025-02-28 |
|
PDBID: | 9m2t | Status: | HPUB -- hold until publication | Title: | Crystal structure of glycerol kinase from Entamoeba histolytica complexed with AMP-PNP and glycerol. | Authors: | Balogun, E.O., Jeelani, G., Hane, E., Kondo, H., Hasegawa, Y., Kojima, C., Chishima, T., Harada, S., Kishikawa, J., Nozaki, T., Shiba, T. | Deposition date: | 2025-02-28 |
|
PDBID: | 9njw | Status: | HPUB -- hold until publication | Title: | Structure of ancestral-reconstructed cytochrome P450 11A1 (CYP11A1) in complex with cholesterol | Authors: | Chagas, B.C., Wang, P.C., Brixius-Anderko, S. | Deposition date: | 2025-02-28 |
|
PDBID: | 9njm | Status: | HPUB -- hold until publication | Title: | hMCT1-BSGiso2-INX444 | Authors: | Lo, Y.-H., Dorsey, F.C. | Deposition date: | 2025-02-27 |
|
PDBID: | 9q9t | Status: | HPUB -- hold until publication | Title: | Human ROCK2 in complex with a dihydropyrazolo-pyrimidine inhibitor | Authors: | Pala, D., Clark, D., Accetta, A., Rancati, F., Edwards, C. | Deposition date: | 2025-02-26 | Sequence: | >Entity 1 GAAGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFPALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMDETGMVHCDTAVGTPDYISPEVLKSQGGDGFYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIRQHPFFKNDQWHWDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYR
|
|
PDBID: | 9q9b | Status: | AUTH -- processed, waiting for author review and approval | Title: | Protein kinase CK2 catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment C07 and CX-4945 (Silmitasertib) | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | Deposition date: | 2025-02-26 |
|
PDBID: | 9q9c | Status: | HPUB -- hold until publication | Title: | CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment D04 | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | Deposition date: | 2025-02-26 |
|
PDBID: | 9q9d | Status: | HPUB -- hold until publication | Title: | CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment D04 and CX-4945 (Silmitasertib) | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | Deposition date: | 2025-02-26 |
|
PDBID: | 9q9g | Status: | HPUB -- hold until publication | Title: | CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment D10 | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | Deposition date: | 2025-02-26 |
|
PDBID: | 9m20 | Status: | HPUB -- hold until publication | Title: | GmMAN19-1 from Glycine max | Authors: | Lin, C.J., Hsu, C.H. | Deposition date: | 2025-02-26 |
|
PDBID: | 9m1w | Status: | HPUB -- hold until publication | Title: | Crystal structure of N-prenyltransferase DsKabA | Authors: | Huang, W.J., Hsu, C.H. | Deposition date: | 2025-02-26 |
|
PDBID: | 9m21 | Status: | HPUB -- hold until publication | Title: | GmMAN19-1 from Glycine max in complex with mannopentaose | Authors: | Lin, C.J., Hsu, C.H. | Deposition date: | 2025-02-26 |
|
PDBID: | 9niw | Status: | HPUB -- hold until publication | Title: | Fab1550 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein | Authors: | Moskovitz, R., Wilson, I.A. | Deposition date: | 2025-02-26 |
|
PDBID: | 9niy | Status: | HPUB -- hold until publication | Title: | Fab1393 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein | Authors: | Moskovitz, R., Wilson, I.A. | Deposition date: | 2025-02-26 |
|