PDBID: | 8vrp | Status: | HPUB -- hold until publication | Title: | HIV-CA Disulfide linked Hexamer bound to 4-Quinazolinone Scaffold inhibitor | Authors: | Goldstone, D.C., Walsham, L. | Deposition date: | 2024-01-22 | Release date: | 2025-07-21 | Sequence: | >Entity 1 PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKAR
|
|
PDBID: | 8vqu | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Dehaloperoxidase B in complex with substrate 1,4-cyclohexadiene | Authors: | de Seerano, V.S., Yun, D., Ghiladi, R.A. | Deposition date: | 2024-01-19 |
|
PDBID: | 8vqs | Status: | HPUB -- hold until publication | Title: | Crystal structure of Dehaloperoxidase B in complex with substrate cyclohexene | Authors: | de Serrano, V.S., Yun, D., Ghiladi, R.A. | Deposition date: | 2024-01-19 |
|
PDBID: | 8vqt | Status: | HPUB -- hold until publication | Title: | Cryatal structure of Dehaloperoxidase B in complex with substrate 1-methyl-cyclohexene | Authors: | de Serrano, V.S., Yun, D., Ghiladi, R.A. | Deposition date: | 2024-01-19 |
|
PDBID: | 8rkm | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Single chain shwanavidin-linker-shwanavidin (F43A) | Authors: | Livnah, O., Gutman, D. | Deposition date: | 2023-12-27 |
|
PDBID: | 8rkk | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Single chain Shwanavidin-linker-Shwanavidin | Authors: | Livnah, O., Avraham, O., Gutman, D. | Deposition date: | 2023-12-26 |
|
PDBID: | 8rcx | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Crystal structure of the Mycobacterium tuberculosis regulator VirS (N-terminal fragment 4-208) in complex with the drug candidate alpibectir | Authors: | Edoo, Z., Frita, R., Grosse, C., Bourotte, M., Moune, M., Antoine, R., Trebosc, V., Schellhorn, B., Dreneau, A., Hofmann, L., Kemmer, C., Lociuro, S., Dale, G.E., Jung, F., Perez-Herran, E., Mendoza, A., Rebollo Lopez, M.J., Ghidelli-Disse, S., Drewes, G., Mathys, V., Soetaert, K., Megalizzi, V., Wintjens, R., Barros Aguirre, D., Remuinan, M.D., Gitzinger, M., Deprez, B., Willand, N., Pieren, M., Baulard, A.R. | Deposition date: | 2023-12-07 |
|
PDBID: | 8r77 | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Ficin C crystal form 2 | Authors: | Loris, R., Baeyens-Volant, D., Azarkan, M., Kerff, F. | Deposition date: | 2023-11-23 |
|
PDBID: | 8qza | Status: | HPUB -- hold until publication | Title: | D-2-hydroxyacid dehydrogenase (D2-HDH) from Haloferax mediterranei apo-enzyme (2.25 A resolution) | Authors: | Baker, P.J., Barrett, J.R., Dakhil, A.A.A.B., Domenech, J., Bisson, C., Pramanpol, N., Sedelnikova, S.E., Ferrer, J., Rice, D.W. | Deposition date: | 2023-10-26 | Release date: | 2025-07-26 |
|
PDBID: | 8ugx | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Cryo-EM structure of Prefusion-stabilized RSV F (DS-Cav1, M16 strain) in complex with Fab 2M03 | Authors: | Xian, Y., Harshbarger, W.D. | Deposition date: | 2023-10-06 |
|
PDBID: | 7r2n | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | elongated Cascade complex from type I-A CRISPR-Cas system in an active state | Authors: | Hu, C., Ni, D., Nam, K.H., Terns, M., Stahlberg, H. | Deposition date: | 2022-02-04 |
|
PDBID: | 7n9p | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Estrogen Receptor Alpha Ligand Binding Domain in Complex with ICI164,384 | Authors: | Diennet, M., El Ezzy, M., Thiombane, K., Cotnoir-White, D., Poupart, J., Gao, Z., Mendoza, S.R., Marinier, A., Gleason, J., Mader, S.C., Fanning, S.W. | Deposition date: | 2021-06-18 |
|
PDBID: | 7n9m | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Estrogen Receptor Alpha Ligand Binding Domain in Complex with Aliphatic SERD S-C10(13) | Authors: | Diennet, M., El Ezzy, M., Thiombane, K., Cotnoir-White, D., Poupart, J., Gao, Z., Mendoza, S.R., Marinier, A., Gleason, J., Mader, S.C., Fanning, S.W. | Deposition date: | 2021-06-18 |
|
PDBID: | 7n9n | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Estrogen Receptor Alpha Ligand Binding Domain in Complex with Aliphatic SERD S-C10(14) | Authors: | Diennet, M., El Ezzy, M., Thiombane, K., Cotnoir-White, D., Poupart, J., Gao, Z., Mendoza, S.R., Marinier, A., Gleason, J., Mader, S.C., Fanning, S.W. | Deposition date: | 2021-06-18 |
|
PDBID: | 2m95 | Status: | POLC -- waiting for a policy decision | Title: | Ferredoxin Competes with Bacterial Frataxin in Binding to the Desulfurase IscS | Authors: | Konarev, P.V., Iannuzzi, C., Adinolfi, S., Roche, B., Kelly, G., Simon, L., Martin, S.R., Py, B., Barras, F., Svergun, D.I. | Deposition date: | 2013-06-03 |
|
PDBID: | 4ajq | Status: | POLC -- waiting for a policy decision | Title: | 3D RNA structure of the major HIV-1 packaging signal region | Authors: | Stephenson, J.D., Kenyon, J.C., Li, H., Symmons, M., Klenerman, D., Lever, A.M.L. | Deposition date: | 2012-02-16 |
|
PDBID: | 3n8o | Status: | POLC -- waiting for a policy decision | Title: | Unique solution structure of human complement Factor H | Authors: | Okemefuna, A.I., Gor, J., Sadlon, T., Adamson, P., Gordon, D.L., Perkins, S.J. | Deposition date: | 2010-05-28 |
|
PDBID: | 3n8p | Status: | POLC -- waiting for a policy decision | Title: | Solution Structure of SCR-8/11 of human complement Factor H | Authors: | Okemefuna, A.I., Gor, J., Sadlon, T., Adamson, P., Gordon, D.L., Perkins, S.J. | Deposition date: | 2010-05-28 |
|
PDBID: | 3n8q | Status: | POLC -- waiting for a policy decision | Title: | Solution structure of SCR-11/15 of human complement Factor H | Authors: | Okemefuna, A.I., Gor, J., Sadlon, T., Adamson, P., Gordon, D.L., Perkins, S.J. | Deposition date: | 2010-05-28 |
|
PDBID: | 3m7x | Status: | POLC -- waiting for a policy decision | Title: | SOLUTION STRUCTURE OF IgG4 ANTIBODY AT 1.3 MG/ML | Authors: | Perkins, S.J., Dalby, P.A., Abe, Y., Bracewell, D.G., Gor, J. | Deposition date: | 2010-03-17 |
|
PDBID: | 3m80 | Status: | POLC -- waiting for a policy decision | Title: | SOLUTION STRUCTURE OF IgG4 ANTIBODY AT 0.3 MG/ML | Authors: | Perkins, S.J., Dalby, P.A., Abe, Y., Bracewell, D.G., Gor, J. | Deposition date: | 2010-03-17 |
|
PDBID: | 3m7y | Status: | POLC -- waiting for a policy decision | Title: | SOLUTION STRUCTURE OF IgG4 ANTIBODY AT 0.98 MG/ML | Authors: | Perkins, S.J., Dalby, P.A., Abe, Y., Bracewell, D.G., Gor, J. | Deposition date: | 2010-03-17 |
|
PDBID: | 3m7z | Status: | POLC -- waiting for a policy decision | Title: | SOLUTION STRUCTURE OF IgG4 ANTIBODY AT 0.65 MG/ML | Authors: | Perkins, S.J., Dalby, P.A., Abe, Y., Bracewell, D.G., Gor, J. | Deposition date: | 2010-03-17 |
|
PDBID: | 2ks7 | Status: | POLC -- waiting for a policy decision | Title: | Assignment and structural characterization of intrinsically disordered CDK inhibitor phosphoSic1 from yeast | Authors: | Mittag, T., Choy, W., Marsh, J., Orlicky, S., Grishaev, A., Lin, H., Sicheri, F., Tyers, M., Forman-Kay, J.D. | Deposition date: | 2009-12-30 |
|
PDBID: | 2ks8 | Status: | POLC -- waiting for a policy decision | Title: | Assignment and structural characterization of intrinsically disordered CDK inhibitor Sic1 from yeast | Authors: | Mittag, T., Choy, W., Marsh, J., Orlicky, S., Grishaev, A., Lin, H., Sicheri, F., Tyers, M., Forman-Kay, J.D. | Deposition date: | 2009-12-30 |
|