Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9npm
Status:AUTH -- processed, waiting for author review and approval
Title:Composite map of three pairs of dimeric VRC36 Fabs bound to HIV-1 BG505.T332N DS-SOSIP.664 Env trimer
Authors:Cheng, J., Cale, E.M., Longo, N., Sutton, M.S., Lei, H., Huang, R., Morton, A.J., Lang, Z.C., Morano, N.C., Roark, R.S., Becker, J.E., Tsybovsky, Y., Li, N., Zhang, B., Du, H., Rubin, S., Shapiro, L., Pierson, T.C., Doria-Rose, N.A., Zhou, T., Kwong, P.D.
Deposition date:2025-03-11
PDBID:9m7g
Status:HPUB -- hold until publication
Title:Cryo-EM structure of the human glucagon receptor (GCGR) in ligand free state resolved via the fusion/crosslinking strategy
Authors:Han, S.C., Li, M.H.
Deposition date:2025-03-10
PDBID:9m7h
Status:HPUB -- hold until publication
Title:Cryo-EM structure of the orphan receptor GPRC5D in ligand free state resolved via the fusion/crosslinking strategy
Authors:Han, S.C., Li, M.H.
Deposition date:2025-03-10
PDBID:9m7k
Status:HPUB -- hold until publication
Title:Heptamer Msp1 from S.cerevisiae (with a catalytic dead mutation) in complex with an unknown peptide substrate
Authors:Chengdong, H., Simin, W., Xuan, C.
Deposition date:2025-03-10
PDBID:9qe2
Status:HPUB -- hold until publication
Title:Mouse otoferlin (216-1931) in complex with an MSP2N2 lipid nanodisc (30 mol% DOPS, 10 mol% PI(4,5)P2)
Authors:Cretu, C., Moser, T.
Deposition date:2025-03-07
PDBID:9m65
Status:HPUB -- hold until publication
Title:Crystal structure of the pathogen-secreted apoplastic GH12 xyloglucan-specific endoglucanase XEG1
Authors:Xia, Y.Q., Liu, L., Zhang, Q., Shi, X.C., Wang, Z.K., Zhang, Z.C., He, X.Y., Xiao, J.H., Jiang, H.B., Zhang, S.C., Yang, Y.H., Ye, W.W., Wang, Z.Y., Wang, Y., Ma, Z.C., Yang, Q., Wang, Y.C.
Deposition date:2025-03-07
PDBID:9qdk
Status:HPUB -- hold until publication
Title:Trypanosoma brucei PTR1 in complex with fragment L330 and compound F46
Authors:Landi, G., Mangani, S., Pozzi, C.
Deposition date:2025-03-06
Sequence:

>Entity 1


MGSSHHHHHHSSGLVPRGSHMEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
PDBID:9qdo
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of the aromatic oligoamide foldamer binder Nanofitin C10 fused to a coiled-coil domain
Authors:Sigl, J.C., Morozov, V., Huc, I.
Deposition date:2025-03-06
PDBID:9m5k
Status:HPUB -- hold until publication
Title:The cryo-EM structure of in situ amplified (ISA) alpha-synuclein fibrils from PD homogenate
Authors:Cao, T.Y., Zhao, Q.Y., Liu, C., Li, D.
Deposition date:2025-03-06
PDBID:9m5l
Status:HPUB -- hold until publication
Title:The cryo-EM structure of in situ amplified (ISA) alpha-synuclein fibrils from DLB homogenate
Authors:Cao, T.Y., Zhao, Q.Y., Liu, C., Li, D.
Deposition date:2025-03-06
PDBID:9qcs
Status:AUTH -- processed, waiting for author review and approval
Title:Ku80 mediated DNA-PK dimer bound to 153 bp H2AX nucleosome
Authors:Hall, C., Chaplin, A.K.
Deposition date:2025-03-05
PDBID:9qd3
Status:HPUB -- hold until publication
Title:Gluthathion-S-Transferase StyI of Gordonia rubripertincta CWB2
Authors:Burnik, J., Lienkamp, A.C., Hofmann, E., Tischler, D.
Deposition date:2025-03-05
PDBID:9qcr
Status:AUTH -- processed, waiting for author review and approval
Title:DNA-PK bound to 153 bp H2AX nucleosome model 2
Authors:Hall, C., Chaplin, A.
Deposition date:2025-03-05
PDBID:9qch
Status:HPUB -- hold until publication
Title:Complex of Ovine Serum Albumin with Cephalosporin C
Authors:Duszynski, K., Talaj, J.A., Bujacz, A., Bujacz, G.
Deposition date:2025-03-04
Sequence:

>Entity 1


DTHKSEIAHRFNDLGEENFQGLVLIAFSQYLQQCPFDEHVKLVKELTEFAKTCVADESHAGCDKSLHTLFGDELCKVATLRETYGDMADCCEKQEPERNECFLNHKDDSPDLPKLKPEPDTLCAEFKADEKKFWGKYLYEVARRHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPKIDAMREKVLASSARQRLRCASIQKFGERALKAWSVARLSQKFPKADFTDVTKIVTDLTKVHKECCHGDLLECADDRADLAKYICDHQDALSSKLKECCDKPVLEKSHCIAEVDKDAVPENLPPLTADFAEDKEVCKNYQEAKDVFLGSFLYEYSRRHPEYAVSVLLRLAKEYEATLEDCCAKEDPHACYATVFDKLKHLVDEPQNLIKKNCELFEKHGEYGFQNALIVRYTRKAPQVSTPTLVEISRSLGKVGTKCCAKPESERMPCTEDYLSLILNRLCVLHEKTPVSEKVTKCCTESLVNRRPCFSDLTLDETYVPKPFDEKFFTFHADICTLPDTEKQIKKQTALVELLKHKPKATDEQLKTVMENFVAFVDKCCAADDKEGCFVLEGPKLVASTQAALA
PDBID:9qcd
Status:HPUB -- hold until publication
Title:Micro-ED structure of the NSH2-CSH2 tandem domain of SHP2 in complex with the bis-phosphorylated pY627-pY659-Gab1 (613-694) peptide
Authors:Machner, L., Shaikhqasem, A., Hamdi, F., Breithaupt, C., Parthier, C., Kyrilis, F.L., Kastritis, P.L., Feller, S.M., Stubbs, M.T.
Deposition date:2025-03-04
PDBID:9qcj
Status:HPUB -- hold until publication
Title:Crystal structure of PhoC wild type acid phosphatase
Authors:Levy, C.W., Ortmayer, M.
Deposition date:2025-03-04
PDBID:9qci
Status:HPUB -- hold until publication
Title:Crystal structure of PhoC mutant acid phosphatase
Authors:Levy, C.W., Ortmayer, M.
Deposition date:2025-03-04
PDBID:9m4m
Status:HPUB -- hold until publication
Title:Crystal structure of human DHODH in complex with Lapachol derivatives, 511-12
Authors:Pemba, M.C., Sakurai, Y., Kurosaki, Y., Amalia, E., Inaoka, D.K., Davey, A.R., Shiba, T., Kita, K., Yasuda, J.
Deposition date:2025-03-04
PDBID:9m4o
Status:HPUB -- hold until publication
Title:Crystal structure of human DHODH in complex with Lapachol
Authors:Pemba, M.C., Sakurai, Y., Kurosaki, Y., Amalia, E., Inaoka, D.K., Davey, A.R., Shiba, T., Kita, K., Yasuda, J.
Deposition date:2025-03-04
PDBID:9qbv
Status:HPUB -- hold until publication
Title:Crystal structure of WRN in complex with (R)-11 (GSK4766470)
Authors:Chaikuad, A., Concha, N., Chun, C.-W.
Deposition date:2025-03-03
PDBID:9qbu
Status:HPUB -- hold until publication
Title:Crystal structure of WRN in complex with (S)-27 (GSK5819992)
Authors:Chaikuad, A., Chun, C.-W.
Deposition date:2025-03-03
PDBID:9nli
Status:AUTH -- processed, waiting for author review and approval
Title:GloR, native, unmodified
Authors:Cuthbert, B.J., de Miranda, R., Martinez, J., Goulding, C.W.
Deposition date:2025-03-03
Release date:2026-03-03
PDBID:7i23
Status:AUTH -- processed, waiting for author review and approval
Title:Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0016618-001 (A71EV2A-x1346)
Authors:Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F.
Deposition date:2025-03-03
PDBID:7i24
Status:AUTH -- processed, waiting for author review and approval
Title:Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0016733-001 (A71EV2A-x1445)
Authors:Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F.
Deposition date:2025-03-03
PDBID:7i25
Status:AUTH -- processed, waiting for author review and approval
Title:Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0025240-002 (A71EV2A-x1778)
Authors:Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F.
Deposition date:2025-03-03

243083

數據於2025-10-15公開中

PDB statisticsPDBj update infoContact PDBjnumon