| PDBID: | 8q7g | | Status: | HPUB -- hold until publication | | Title: | Human Carbonic Anhydrase I in complex with 3,4-dihydro-1H-benzo[c][1,2]oxaborinin-1-ol pH 7.0 | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2023-08-16 | | Sequence: | >Entity 1
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
| PDBID: | 8kfq | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of EGFR(T797M/L858R) with small molecule inhibitor B6 | | Authors: | Wu, C., Ouyang, L. | | Deposition date: | 2023-08-16 |
|
| PDBID: | 8kf1 | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of AV-45 bound type1 amyloid beta 42 fibril. | | Authors: | Zhao, Q.Y., Tao, Y.Q., Liu, C., Li, D. | | Deposition date: | 2023-08-15 |
|
| PDBID: | 8kf3 | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of type3 amyloid beta 42 fibril. | | Authors: | Zhao, Q.Y., Tao, Y.Q., Liu, C., Li, D. | | Deposition date: | 2023-08-15 |
|
| PDBID: | 8kf6 | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of AV-45 bound type3 amyloid beta 42 fibril. | | Authors: | Zhao, Q.Y., Tao, Y.Q., Liu, C., Li, D. | | Deposition date: | 2023-08-15 |
|
| PDBID: | 8kf4 | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of type1 amyloid beta 42 fibril in AD2 patient. | | Authors: | Zhao, Q.Y., Tao, Y.Q., Liu, C., Li, D. | | Deposition date: | 2023-08-15 |
|
| PDBID: | 8kf5 | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of type1 amyloid beta 42 fibril in AD3. | | Authors: | Zhao, Q.Y., Tao, Y.Q., Liu, C., Li, D. | | Deposition date: | 2023-08-15 |
|
| PDBID: | 8kfb | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Intracellular B30.2 Domain of VpBTN3 in Complex with HMBPP-08 | | Authors: | Yang, Y.Y., Yi, S.M., Zhang, M.T., Chen, C.-C., Guo, R.-T. | | Deposition date: | 2023-08-15 |
|
| PDBID: | 8kfc | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Intracellular B30.2 Domain of VpBTN3 in Complex with DMASPP | | Authors: | Yang, Y.Y., Yi, S.M., Zhang, M.T., Chen, C.-C., Guo, R.-T. | | Deposition date: | 2023-08-15 |
|
| PDBID: | 8q6l | | Status: | HPUB -- hold until publication | | Title: | human Carbonic Anhydrase I in complex with 3,4-dihydro-1H-benzo[c][1,2]oxaborinin-1-ol | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2023-08-13 | | Sequence: | >Entity 1
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
| PDBID: | 8kew | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of type1 amyloid beta 42 fibril. | | Authors: | Zhao, Q.Y., Tao, Y.Q., Liu, C., Li, D. | | Deposition date: | 2023-08-13 |
|
| PDBID: | 8tt8 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Joint Xray/Neutron structure of Macrophage Migration Inhibitory Factor (MIF) Bound to 4-hydroxyphenylpyruvate at room temperature | | Authors: | Schroder, G.C., Meilleur, F., Crichlow, G.V., Lolis, E.J. | | Deposition date: | 2023-08-13 |
|
| PDBID: | 8tt9 | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of Macrophage Migration Inhibitory Factor (MIF) Covalently Bound to 4-hydroxyphenylpyruvate (HPP) | | Authors: | Schroder, G.C., Meilleur, F., Nix, J.C., Crichlow, G.V., Lolis, E.J. | | Deposition date: | 2023-08-13 | | Sequence: | >Entity 1
PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
|
|
| PDBID: | 8q6d | | Status: | HPUB -- hold until publication | | Title: | Anaerobic crystal structure of HIF prolyl hydroxylase 2 (PHD2 181-407) in complex with HIF2alpha-CODD peptide (523-542), Fe(II) and 2-oxoglutarate (2OG) | | Authors: | Fiorini, G., Figg Jr, W.D., Schofield, C.J. | | Deposition date: | 2023-08-11 |
|
| PDBID: | 8q6e | | Status: | HPUB -- hold until publication | | Title: | Aerobic crystal structure of HIF prolyl hydroxylase 2 (PHD2 181-407) in complex with Fe(III), 2-oxoglutarate (2OG) and HIF2alpha-CODD peptide | | Authors: | Fiorini, G., Figg Jr, W.D., Schofield, C.J. | | Deposition date: | 2023-08-11 |
|
| PDBID: | 7gau | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition of ground-state model of MAP1LC3B | | Authors: | Kumar, A., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von-Delft, F., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2023-08-11 |
|
| PDBID: | 8q64 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of hydroxylated HIF2alpha-CODD peptide (523-542) bound to apo-HIF prolyl hydroxylase 2 (PHD2 181-407) | | Authors: | Fiorini, G., Figg Jr, W.D., Schofield, C.J. | | Deposition date: | 2023-08-10 |
|
| PDBID: | 7ga8 | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of MAP1LC3B in complex with Z1198158918 | | Authors: | Kumar, A., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von-Delft, F., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2023-08-10 |
|
| PDBID: | 7ga9 | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of MAP1LC3B in complex with Z1198177230 | | Authors: | Kumar, A., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von-Delft, F., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2023-08-10 |
|
| PDBID: | 7gaa | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of MAP1LC3B in complex with Z1198233191 | | Authors: | Kumar, A., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von-Delft, F., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2023-08-10 |
|
| PDBID: | 7gab | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of MAP1LC3B in complex with Z1255402624 | | Authors: | Kumar, A., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von-Delft, F., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2023-08-10 |
|
| PDBID: | 7gac | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of MAP1LC3B in complex with Z1456069604 | | Authors: | Kumar, A., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von-Delft, F., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2023-08-10 |
|
| PDBID: | 7gad | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of MAP1LC3B in complex with Z1667545918 | | Authors: | Kumar, A., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von-Delft, F., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2023-08-10 |
|
| PDBID: | 7gae | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of MAP1LC3B in complex with Z1688504114 | | Authors: | Kumar, A., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von-Delft, F., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2023-08-10 |
|
| PDBID: | 7gaf | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of MAP1LC3B in complex with Z183352334 | | Authors: | Kumar, A., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von-Delft, F., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2023-08-10 |
|
