Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9m9n
Status:HPUB -- hold until publication
Title:Crystal Structure of SARS-CoV-2 Main Protease (Mpro) Mutant del23.
Authors:Shin, S.C., Seo, J.J., Yoon, J.M.
Deposition date:2025-03-13
PDBID:9m9h
Status:HPUB -- hold until publication
Title:NMR structure of ProteinMPNN-designed ubiquitin variant R4
Authors:Wu, K.-P., Chen, L.-Y., Chuang, W.-C.
Deposition date:2025-03-13
PDBID:9m9r
Status:HPUB -- hold until publication
Title:Crystal Structure of SARS-CoV-2 Main Protease (Mpro) Mutant del23 in Complex with Nirmatrelvir
Authors:Shin, S.C., Seo, J.J., Yoon, J.M.
Deposition date:2025-03-13
PDBID:9ma1
Status:HPUB -- hold until publication
Title:Crystal structure of MctB from Mycobacterium tuberculosis at 3.25 Angstroms resolution
Authors:Sun, D.M., Chen, L., Wu, M.H., Zang, J.Y., Tian, C.L.
Deposition date:2025-03-13
PDBID:9nqr
Status:AUTH -- processed, waiting for author review and approval
Title:Structure of primary RISC(pri-RISC)
Authors:Zhang, H., Adhav, V.A., Kehling, A.C., Nakanishi, K.
Deposition date:2025-03-13
PDBID:9nqs
Status:HPUB -- hold until publication
Title:Structure of passenger-ejecting RISC (ej-RISC)
Authors:Zhang, H., Adhav, V.A., Kehling, A.C., Nakanishi, K.
Deposition date:2025-03-13
PDBID:7i8s
Status:AUTH -- processed, waiting for author review and approval
Title:Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0024999-003 (A71EV2A-x1775)
Authors:Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F.
Deposition date:2025-03-13
PDBID:7i8t
Status:AUTH -- processed, waiting for author review and approval
Title:Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0030340-001 (A71EV2A-x2290)
Authors:Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F.
Deposition date:2025-03-13
PDBID:7i8u
Status:AUTH -- processed, waiting for author review and approval
Title:Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0019110-002 (A71EV2A-x2454)
Authors:Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F.
Deposition date:2025-03-13
PDBID:7i8v
Status:AUTH -- processed, waiting for author review and approval
Title:Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0030531-001 (A71EV2A-x2629)
Authors:Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F.
Deposition date:2025-03-13
PDBID:7i8w
Status:AUTH -- processed, waiting for author review and approval
Title:Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0018935-002 (A71EV2A-x3066)
Authors:Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F.
Deposition date:2025-03-13
PDBID:9qez
Status:HPUB -- hold until publication
Title:Carbonic anhydrase mutant
Authors:Mohsin, I., Papageorgiou, A.C.
Deposition date:2025-03-11
PDBID:9qfc
Status:HPUB -- hold until publication
Title:Tankyrase 2 ARC4 in complex with a pyrrolone-based inhibitor
Authors:Bosetti, C., Paakkonen, J., Lehtio, L.
Deposition date:2025-03-11
PDBID:9npm
Status:AUTH -- processed, waiting for author review and approval
Title:Composite map of three pairs of dimeric VRC36 Fabs bound to HIV-1 BG505.T332N DS-SOSIP.664 Env trimer
Authors:Cheng, J., Cale, E.M., Longo, N., Sutton, M.S., Lei, H., Huang, R., Morton, A.J., Lang, Z.C., Morano, N.C., Roark, R.S., Becker, J.E., Tsybovsky, Y., Li, N., Zhang, B., Du, H., Rubin, S., Shapiro, L., Pierson, T.C., Doria-Rose, N.A., Zhou, T., Kwong, P.D.
Deposition date:2025-03-11
PDBID:9m7g
Status:HPUB -- hold until publication
Title:Cryo-EM structure of the human glucagon receptor (GCGR) in ligand free state resolved via the fusion/crosslinking strategy
Authors:Han, S.C., Li, M.H.
Deposition date:2025-03-10
PDBID:9m7h
Status:HPUB -- hold until publication
Title:Cryo-EM structure of the orphan receptor GPRC5D in ligand free state resolved via the fusion/crosslinking strategy
Authors:Han, S.C., Li, M.H.
Deposition date:2025-03-10
PDBID:9m7k
Status:HPUB -- hold until publication
Title:Heptamer Msp1 from S.cerevisiae (with a catalytic dead mutation) in complex with an unknown peptide substrate
Authors:Chengdong, H., Simin, W., Xuan, C.
Deposition date:2025-03-10
PDBID:9qe2
Status:HPUB -- hold until publication
Title:Mouse otoferlin (216-1931) in complex with an MSP2N2 lipid nanodisc (30 mol% DOPS, 10 mol% PI(4,5)P2)
Authors:Cretu, C., Moser, T.
Deposition date:2025-03-07
PDBID:9m65
Status:HPUB -- hold until publication
Title:Crystal structure of the pathogen-secreted apoplastic GH12 xyloglucan-specific endoglucanase XEG1
Authors:Xia, Y.Q., Liu, L., Zhang, Q., Shi, X.C., Wang, Z.K., Zhang, Z.C., He, X.Y., Xiao, J.H., Jiang, H.B., Zhang, S.C., Yang, Y.H., Ye, W.W., Wang, Z.Y., Wang, Y., Ma, Z.C., Yang, Q., Wang, Y.C.
Deposition date:2025-03-07
PDBID:9qdk
Status:HPUB -- hold until publication
Title:Trypanosoma brucei PTR1 in complex with fragment L330 and compound F46
Authors:Landi, G., Mangani, S., Pozzi, C.
Deposition date:2025-03-06
Sequence:

>Entity 1


MGSSHHHHHHSSGLVPRGSHMEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
PDBID:9qdo
Status:HPUB -- hold until publication
Title:Crystal structure of the aromatic oligoamide foldamer binder Affitin C10 fused to a coiled-coil domain
Authors:Sigl, J.C., Morozov, V., Huc, I.
Deposition date:2025-03-06
PDBID:9m5k
Status:HPUB -- hold until publication
Title:The cryo-EM structure of in situ amplified (ISA) alpha-synuclein fibrils from PD homogenate
Authors:Cao, T.Y., Zhao, Q.Y., Liu, C., Li, D.
Deposition date:2025-03-06
PDBID:9m5l
Status:HPUB -- hold until publication
Title:The cryo-EM structure of in situ amplified (ISA) alpha-synuclein fibrils from DLB homogenate
Authors:Cao, T.Y., Zhao, Q.Y., Liu, C., Li, D.
Deposition date:2025-03-06
PDBID:9qd3
Status:HPUB -- hold until publication
Title:Gluthathion-S-Transferase StyI of Gordonia rubripertincta CWB2
Authors:Burnik, J., Lienkamp, A.C., Hofmann, E., Tischler, D.
Deposition date:2025-03-05
PDBID:9qcr
Status:AUTH -- processed, waiting for author review and approval
Title:DNA-PK bound to 153 bp H2AX nucleosome model 2
Authors:Hall, C., Chaplin, A.
Deposition date:2025-03-05

242500

數據於2025-10-01公開中

PDB statisticsPDBj update infoContact PDBjnumon