Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9nwu
Status:HPUB -- hold until publication
Title:Crystal structure of a high affinity Lv-Hv tetrabody for the erythropoietin receptor
Authors:Singer, A.U., Bruce, H.A., Yang, N., Blazer, L.L., Adams, J.J., Sidhu, S.S.
Deposition date:2025-03-24
Sequence:

>Entity 1


DIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQSSYSLITFGQGTKVEIKGGGGGEVQLVESGGGLVQPGGSLRLSCAASGFNLRSYYMHWVRQAPGKGLEWVASISPYYSYTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARHGYGAMDYWGQGTLVTVSS
PDBID:9nwl
Status:HPUB -- hold until publication
Title:Crystal structure of glycine-betaine demethylase subunit GbcA from Pseudomonas aeruginosa
Authors:Tan, K., Joachimiak, A., Munoz-Clares, R.A.
Deposition date:2025-03-24
PDBID:9nwx
Status:HPUB -- hold until publication
Title:Discovery of a Small Molecule ITK and Pan-TRK Kinase Inhibitor (PF-07245303) for the Potential Topical Treatment of Atopic Dermatitis
Authors:Liu, S.
Deposition date:2025-03-24
PDBID:9qn7
Status:HPUB -- hold until publication
Title:Structure of talin in complex with a peptide fragment
Authors:Zacharchenko, T.
Deposition date:2025-03-24
PDBID:9qmr
Status:HPUB -- hold until publication
Title:APH(2'''')-Id with a fragment
Authors:Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalemski, J., Lionne, C.
Deposition date:2025-03-24
PDBID:9qn6
Status:AUTH -- processed, waiting for author review and approval
Title:APH(2'''')-IVa with a fragment
Authors:Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalemski, J., Lionne, C.
Deposition date:2025-03-24
PDBID:7i92
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal Structure of 9 bound to the ph domain of Btk
Authors:Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M.
Deposition date:2025-03-24
PDBID:7i93
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal Structure of 27 bound to the ph domain of Btk
Authors:Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M.
Deposition date:2025-03-24
PDBID:7i98
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal Structure of 10 bound to the ph domain of Btk
Authors:Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M.
Deposition date:2025-03-24
PDBID:7i99
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal Structure of 22 bound to the ph domain of Btk
Authors:Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M.
Deposition date:2025-03-24
PDBID:7i9a
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal Structure of 24 bound to the ph domain of Btk
Authors:Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M.
Deposition date:2025-03-24
PDBID:7i9b
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal Structure of 32 bound to the ph domain of Btk
Authors:Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M.
Deposition date:2025-03-24
PDBID:7i9c
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal Structure of 30 bound to the ph domain of Btk
Authors:Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M.
Deposition date:2025-03-24
PDBID:7i9d
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal Structure of 14 bound to the ph domain of Btk
Authors:Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M.
Deposition date:2025-03-24
PDBID:7i9e
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal Structure of 18 bound to the ph domain of Btk
Authors:Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M.
Deposition date:2025-03-24
PDBID:7i9f
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal Structure of 16 bound to the ph domain of Btk
Authors:Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M.
Deposition date:2025-03-24
PDBID:9qms
Status:AUTH -- processed, waiting for author review and approval
Title:DNA-PK bound to 153 bp H2AX nucleosome with ATPyS
Authors:Hall, C., Chaplin, A.K.
Deposition date:2025-03-24
PDBID:9qmo
Status:HPUB -- hold until publication
Title:PLK1 PBD apo protein at 1.6A
Authors:Ren, L., Gasper, R., Vetter, I., Musacchio, A.
Deposition date:2025-03-24
PDBID:7i90
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal Structure of 7 bound to the ph domain of Btk
Authors:Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M.
Deposition date:2025-03-24
PDBID:7i91
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal Structure of 13 bound to the ph domain of Btk
Authors:Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M.
Deposition date:2025-03-24
PDBID:7i94
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal Structure of 33 bound to the ph domain of Btk
Authors:Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M.
Deposition date:2025-03-24
PDBID:7i95
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal Structure of 25 bound to the ph domain of Btk
Authors:Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M.
Deposition date:2025-03-24
PDBID:7i96
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal Structure of 4 bound to the ph domain of Btk
Authors:Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M.
Deposition date:2025-03-24
PDBID:7i97
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal Structure of 8 bound to the ph domain of Btk
Authors:Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M.
Deposition date:2025-03-24
PDBID:7i9g
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal Structure of 28 bound to the ph domain of Btk
Authors:Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M.
Deposition date:2025-03-24

238582

數據於2025-07-09公開中

PDB statisticsPDBj update infoContact PDBjnumon