PDBID: | 9uf5 | Status: | HPUB -- hold until publication | Title: | CTP synthase PRE-state 8 | Authors: | Guo, C.J. | Deposition date: | 2025-04-09 |
|
PDBID: | 9qt8 | Status: | HPUB -- hold until publication | Title: | Polyester Hydrolase Leipzig 7 (PHL7) variant R2M2-P155G | Authors: | Useini, A., Strater, N., Kuenze, G., Sonnendecker, C. | Deposition date: | 2025-04-08 |
|
PDBID: | 9qt7 | Status: | HPUB -- hold until publication | Title: | Crystal structure of affitin C10 fused to a coiled-coil domain in complex with a quinoline oligoamide foldamer | Authors: | Morozov, V., Wang, L., Kwon, S., Douat, C., Huc, I. | Deposition date: | 2025-04-08 |
|
PDBID: | 9qtc | Status: | HPUB -- hold until publication | Title: | HINT1 complexed with GS-441524 | Authors: | Zimberger, C., Ferron, F. | Deposition date: | 2025-04-08 | Sequence: | >Entity 1 MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG
|
|
PDBID: | 9o4t | Status: | HPUB -- hold until publication | Title: | RT XFEL structure of Soybean Lipoxygenase-1 in large unit-cell | Authors: | Wolff, A.M., Thompson, M.C. | Deposition date: | 2025-04-08 |
|
PDBID: | 9o3d | Status: | HPUB -- hold until publication | Title: | Crystal structure of broadly neutralizing antibody HEPC108 in complex with Hepatitis C virus envelope glycoprotein E2 ectodomain | Authors: | Flyak, A.I., Wilcox, X.E. | Deposition date: | 2025-04-07 |
|
PDBID: | 9o3r | Status: | HPUB -- hold until publication | Title: | Crystal Structure of I64A Variant of D-Dopachrome Tautomerase (D-DT) | Authors: | Pilien, A.V.R., Argueta, C., Parkins, A., Pantouris, G. | Deposition date: | 2025-04-07 | Sequence: | >Entity 1 PFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSAGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL
|
|
PDBID: | 9o3m | Status: | HPUB -- hold until publication | Title: | K40F mutant of hCRBPII bound to fentanyl | Authors: | Bingham, C., Geiger, J.H. | Deposition date: | 2025-04-07 | Sequence: | >Entity 1 TRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTFVIDQDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK
|
|
PDBID: | 9qs4 | Status: | HPUB -- hold until publication | Title: | Structure of glycocin glycosyltransferase SacS from Streptomyces platensis | Authors: | Krummhaar, M., Langhans, A., Singh, M., Koksch, B., Roth, C. | Deposition date: | 2025-04-04 |
|
PDBID: | 9qrr | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of glycocin glycosyltransferase SacS from Streptomyces platensis | Authors: | Krummhaar, M., Langhans, A., Singh, M., Koksch, B., Roth, C. | Deposition date: | 2025-04-04 |
|
PDBID: | 9qro | Status: | HPUB -- hold until publication | Title: | HINT1 complexed with GS-441524-MP | Authors: | Zimberger, C., Ferron, F. | Deposition date: | 2025-04-04 | Sequence: | >Entity 1 MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG
|
|
PDBID: | 9qrq | Status: | HPUB -- hold until publication | Title: | Structure of glycocin glycosyltransferase SacS from Streptomyces platensis | Authors: | Krummhaar, M., Langhans, A., Singh, M., Seeberger, P.H., Koksch, B., Roth, C. | Deposition date: | 2025-04-04 |
|
PDBID: | 9qsa | Status: | HPUB -- hold until publication | Title: | Mouse Ribosome rotated-1 PRE state | Authors: | Santo, P.E., Astier, A., Plisson-Chastang, C. | Deposition date: | 2025-04-04 |
|
PDBID: | 9o2v | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM Structure of VgrG4 from Hypervirulent Klebsiella pneumoniae kp52.145 | Authors: | Noske, G.D., Dominguez-Antty, J.H., Paula, T.G., Aleixo, M.A.A., Portugal, R.V., Cunha, M.M.L., Amorim, G.C. | Deposition date: | 2025-04-04 |
|
PDBID: | 9o2y | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Structure of WT E.coli ribosome 70S subunit with complexed with mRNA, P-site fMet-NH-tRNAfMet and A-site (R) beta-2-hydroxy-BocLysine acid charged NH-tRNAPyl | Authors: | Majumdar, C., Cate, J.H.D. | Deposition date: | 2025-04-04 |
|
PDBID: | 9o2x | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Structure of WT E.coli ribosome 70S subunit with complexed with mRNA, P-site fMet-NH-tRNAfMet and A-site (S)-betahydroxyBocK charged NH-tRNAPyl | Authors: | Majumdar, C., Kent, A., Hamlish, N., Zhu, C., Cate, J. | Deposition date: | 2025-04-04 |
|
PDBID: | 9o2w | Status: | HPUB -- hold until publication | Title: | Crystal structure of NDM-1 complexed with compound 3 | Authors: | Jacobs, L.M.C., Chen, Y. | Deposition date: | 2025-04-04 |
|
PDBID: | 9qr4 | Status: | HPUB -- hold until publication | Title: | InlB392_T336Y: T336Y variant of Listeria monocytogenes InlB (internalin B) residues 36-392 | Authors: | Geerds, C., Niemann, H.H. | Deposition date: | 2025-04-03 |
|
PDBID: | 9o18 | Status: | HPUB -- hold until publication | Title: | Fab1504 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein | Authors: | Moskovitz, R., Wilson, I.A. | Deposition date: | 2025-04-03 |
|
PDBID: | 9ubs | Status: | HPUB -- hold until publication | Title: | The structure of the AglA_T220R-Arg complex | Authors: | Sun, Y., Dou, C., Yan, W., Zhou, D., Zhu, X., Cheng, W. | Deposition date: | 2025-04-03 |
|
PDBID: | 9ubt | Status: | HPUB -- hold until publication | Title: | The structure of the AglA-Ampn-Arg complex | Authors: | Sun, Y., Dou, C., Yan, W., Zhou, D., Zhu, X., Cheng, W. | Deposition date: | 2025-04-03 |
|
PDBID: | 9ub2 | Status: | HPUB -- hold until publication | Title: | Crystal structure of human DHODH in complex with inhibitor 006 | Authors: | Jun, L., Zhaomin, X., Caiyue, C., Yuanyuan, Z., Jin, H. | Deposition date: | 2025-04-02 | Release date: | 2026-04-02 |
|
PDBID: | 9ub9 | Status: | HPUB -- hold until publication | Title: | Wild-type Bacillus megaterium Penicillin G Acylase | Authors: | Kaewsasan, C., Rojviriya, C., Yuvaniyama, J. | Deposition date: | 2025-04-02 |
|
PDBID: | 9ub3 | Status: | HPUB -- hold until publication | Title: | The structure of the apo-AglA from Streptomyces monomycini | Authors: | Sun, Y., Dou, C., Yan, W., Zhou, D., Zhu, X., Cheng, W. | Deposition date: | 2025-04-02 |
|
PDBID: | 9ub5 | Status: | HPUB -- hold until publication | Title: | The structure of the AglA-Arg complex | Authors: | Sun, Y., Dou, C., Yan, W., Zhou, D., Zhu, X., Cheng, W. | Deposition date: | 2025-04-02 |
|