| PDBID: | 8ric | | Status: | HPUB -- hold until publication | | Title: | Crystallographic structure of oligosaccharide dehydrogenase from Pycnoporus cinnabarinus bound to Sinapic Acid, tetragonal crystal | | Authors: | Savino, C., Sciara, G., Gugole, E., Vallone, B., Fata, F., Bulfaro, G., Costanzo, A., Montemiglio, L.C. | | Deposition date: | 2023-12-18 |
|
| PDBID: | 8rhd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Neisseria gonorrhoeae FabI in complex with NADH and (E)-3-((2R,3S)-3-hydroxy-2-methyl-4-oxo-2,3,4,5-tetrahydro-1H-pyrido[2,3-b][1,4]diazepin-8-yl)-N-methyl-N-((3-methylbenzofuran-2-yl)methyl)acrylamide | | Authors: | Ronin, C., Gerusz, V., Ciesielski, F. | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8reg | | Status: | HPUB -- hold until publication | | Title: | Lysozyme measured via serial crystallography from a kapton HARE-chip (50 micron) | | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8reh | | Status: | HPUB -- hold until publication | | Title: | Lysozyme measured via serial crystallography from a kapton HARE-chip (125 micron) | | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8rei | | Status: | HPUB -- hold until publication | | Title: | CTX-M-14 measured via serial crystallography from a silicon HARE-chip. | | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8rem | | Status: | HPUB -- hold until publication | | Title: | CTX-M-14 measured via serial crystallography from a kapton HARE-chip (50 micron) | | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8udb | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Mu class GST from TuGSTm12 (Tetur05g05300) from Tetranychus urticae | | Authors: | Khatri, K., Arriaza, R., Chruszcz, M. | | Deposition date: | 2023-09-28 |
|
| PDBID: | 8udd | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Mu class Glutathione-S-Transferase, TuGSTm12(Tetur05g05300) from Tetranychus urticae | | Authors: | Khatri, K., Arriaza, R.H., Chruszcz, M. | | Deposition date: | 2023-09-28 |
|
| PDBID: | 8ude | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Mu class Glutathione-S-Transferase, TuGSTm06(Tetur05g05220) from Tetranychus urticae | | Authors: | Khatri, K., Arriaza, R.H., Chruszcz, M. | | Deposition date: | 2023-09-28 |
|
| PDBID: | 8udh | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Mu class Glutathione-S-Transferase TuGSTm06(Tetur05g05220) in complex with reaction product | | Authors: | Khatri, K., Arriaza, R.H., Chruszcz, M. | | Deposition date: | 2023-09-28 |
|
| PDBID: | 8uda | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Mu class Glutathione-S-Transferase, TuGSTm12(Tetur05g05300) from Tetranychus urticae | | Authors: | Khatri, K., Arriaza, R.H., Chruszcz, M. | | Deposition date: | 2023-09-28 |
|
| PDBID: | 8qkw | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Levansucrase from Pseudomonas syringae in complex with a tetravalent iminosugar | | Authors: | Ferraroni, M., Canovai, A. | | Deposition date: | 2023-09-18 |
|
| PDBID: | 8qht | | Status: | HPUB -- hold until publication | | Title: | Leishmania braziliensis PRMT1-PRMT3 heterotetrameric complex in unliganded form. | | Authors: | Levdikov, V., Nay, E., Walrad, P., Plevin, J.M. | | Deposition date: | 2023-09-10 | | Release date: | 2025-03-10 | | Sequence: | >Entity 1
DYYFDSYSHYGIHMEMLKDYHRTTTYRDAIWRNAYMFKDKVVLDVGCGTGILSMFAARAGARKVIGIDCSNVAVQARQIVQDNGFSDIITIIQGKVEELDLDEKVDIIISEWMGYFLLYESMLNTVLYARDRWGASDVKILPSSANMYACGITDPQYVEQKFNIWNSVNGLDFSYFKRLSYIEPLIDTVNPEQIITDIVPFFSFDINRVTEAELSFTSTFTLEAKQGDFVHAISVHFDTPFYAGHDPVVLNTSPMVPPTHWRQTVLYMFHPLIMKRGEKANFTMKCAPNPGNPRDLDISLHIDFDGELQACHYDQDFRLR
>Entity 2
SAARISSNISTIHDHQRLRAYEVIFRNVRGKTLLHLGCGMGLYSMLAARGMAKMVIGIDSSAIVDAARVVAEQNGLKNIQFIRGRLCEALHQLPSDMKFDYVLCEWMGPLLLNERVLTDALYARDHLLTESGALCPNRASLHVVAVSDYAFRLDTEDFWSNVYGFQMEPMKELVRQEVEMCAIPGSNIVSAPCLAHTIHMDTLEGLTAEETATYEAQANQAAAIRDNEEENPVEHCWVPAAVAQKGYEAAFTLSIARSATVHYLTFYLDAAFTSKTNPGANFVLAVRPGGQNNWTEVSVGLREPLPVNAGEKIQGTVRVYTPAEKGGKVTVVEVTAKTAGQVAAIETFGTYYYQSY
|
|
| PDBID: | 2m4a | | Status: | POLC -- waiting for a policy decision | | Title: | NMR data-driven model of GTPase Rheb-GDP tethered to a lipid-bilayer nanodisc | | Authors: | Mazhab-Jafari, M.T., Stathopulos, P.B., Marshall, C.B., Kobashigawa, Y., Stambolic, V., Kay, L.E., Inagaki, F., Ikura, M. | | Deposition date: | 2013-02-03 |
|
| PDBID: | 2m4b | | Status: | POLC -- waiting for a policy decision | | Title: | NMR data-driven model of GTPase Rheb-GTP tethered to a lipid-bilayer nanodisc | | Authors: | Mazhab-Jafari, M.T., Stathopulos, P.B., Marshall, C.B., Kobashigawa, Y., Stambolic, V., Kay, L.E., Inagaki, F., Ikura, M. | | Deposition date: | 2013-02-03 |
|
| PDBID: | 3ujx | | Status: | POLC -- waiting for a policy decision | | Title: | Solution structures of tetrameric mannose-binding lectin | | Authors: | Miller, A., Phillips, A., Wallis, R., Perkins, S.J. | | Deposition date: | 2011-11-08 |
|
