| PDBID: | 9mrg | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of KwaA tetramer with C2 symmetry | | Authors: | Zhiying, Z., Dinshaw, J.P. | | Deposition date: | 2025-01-07 |
|
| PDBID: | 9lbq | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the heterotetramer Retron-Eco8 complex | | Authors: | Zhang, J.T., Ji, C.G., Jia, N. | | Deposition date: | 2025-01-03 |
|
| PDBID: | 9hv7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Tetraspanin TSPAN10mutant Large Extracellular Loop (LEL) | | Authors: | Nagarathinam, K., Krey, T. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9hux | | Status: | HPUB -- hold until publication | | Title: | CryoEM map of the large glutamate dehydrogenase composed of 180 kDa subunits from Mycobacterium smegmatis obtained in the presence of NAD+ and L-glutamate. Open Tetramer. | | Authors: | Lazaro, M., Chamorro, N., Lopez-Alonso, J.P., Charro, D., Rasia, R.M., Jimenez-Oses, G., Valle, M., Lisa, M.N. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9huy | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | CryoEM map of the large glutamate dehydrogenase composed of 180 kDa subunits from Mycobacterium smegmatis obtained in the presence of NAD+ and L-glutamate. Closed1 tetramer. | | Authors: | Lazaro, M., Chamorro, N., Lopez-Alonso, J.P., Charro, D., Rasia, R.M., Jimenez-Oses, G., Valle, M., Lisa, M.N. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9huz | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | CryoEM map of the large glutamate dehydrogenase composed of 180 kDa subunits from Mycobacterium smegmatis obtained in the presence of NAD+ and L-glutamate. Closed2 tetramer | | Authors: | Lazaro, M., Chamorro, N., Lopez-Alonso, J.P., Charro, D., Rasia, R.M., Jimenez-Oses, G., Valle, M., Lisa, M.N. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9hur | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Tetraspanin CD63mutant Large Extracellular Loop (LEL) in complex with sybody LA4 | | Authors: | Nagarathinam, K., Krey, T. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9mmf | | Status: | HPUB -- hold until publication | | Title: | First structure of Five-tetrad G-Quadruplex | | Authors: | Eyiolowope, J., Xing, E.R., Yatsunyk, L.A. | | Deposition date: | 2024-12-20 |
|
| PDBID: | 9ht6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Tetraspanin CD82 Large Extracellular Loop (LEL) | | Authors: | Nagarathinam, K., Krey, T. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9l0j | | Status: | HOLD -- hold until a certain date | | Title: | Clostridium tetani E88 ncRNA homodimer | | Authors: | Jia, X., Wang, L., Su, Z. | | Deposition date: | 2024-12-12 | | Release date: | 2025-12-12 |
|
| PDBID: | 9meu | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CXCR4 tetramer bound to 4 CXCL12 dimers | | Authors: | Zhang, Z., Patel, D.J. | | Deposition date: | 2024-12-08 |
|
| PDBID: | 9men | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CryoEM structure of hCXCR4 tetramer bound to HIV-2/gp120/V3 loop | | Authors: | Zhang, Z., Patel, D.J. | | Deposition date: | 2024-12-07 |
|
| PDBID: | 9mdu | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human CXCR4 tetramer | | Authors: | Zhang, Z., Patel, D.J., Junyu, X. | | Deposition date: | 2024-12-05 |
|
| PDBID: | 9hdi | | Status: | HPUB -- hold until publication | | Title: | N-terminally truncated CanA from Pyrodictium abyssi - K1-CanA | | Authors: | Munte, C.E., Kalbitzer, H.R., Kreitner, R.R., Stetter, K.O. | | Deposition date: | 2024-11-12 |
|
| PDBID: | 9e8e | | Status: | HPUB -- hold until publication | | Title: | Hybrid G-quadruplex from Tetrahymena thermophila telomeric sequence in complex with TrisQO Form 2 | | Authors: | Ali, A., Yatsunyk, L.A. | | Deposition date: | 2024-11-05 |
|
| PDBID: | 9k7t | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of designed zinc-induced homotetramer C4-Zn1-HEHE-1 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k8a | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of designed zinc-induced tetrahedron Cage-t32-Zn1-HEHE-34 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k8b | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of monomer of designed zinc-induced tetrahedron Cage-t32-Zn1-HEHE-34 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k8c | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of C2 symmetric interface of designed zinc-induced tetrahedron Cage-t32-Zn1-HEHE-34 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 | | Sequence: | >Entity 1
MGHHHHHHHHSSGLEVLFQGPGGTMEKLKEIVKHLEVAIKYLKEGKVDLADLVVADAIELAKEAGDKASLEILKVAHKAIDTLGREGKLEEAAKIVKYAKEYVEAKIKGDREKLRELLEKVKKDVLEAIKKGDEEFYEALVKIARIIAEDLGDEKSLKVLEALEEFFKEWKRLEKEGKSLDEKLHLFLRVGERLLEIGDKESLEMLIELLEELAKEIKKAGNEELLVRAEAAIKDIRKHIKEL
|
|
| PDBID: | 9k8d | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of C3 symmetric interface of designed zinc-induced tetrahedron Cage-t32-Zn1-HEHE-34 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k8e | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of designed zinc-induced tetrahedron Cage-t32-Zn1-HEHE-35 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k8f | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of monomer of designed zinc-induced tetrahedron Cage-t32-Zn1-HEHE-35 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k8g | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of C3 symmetric interface of designed zinc-induced tetrahedron Cage-t32-Zn1-HEHE-35 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k8h | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of C2 symmetric interface of designed zinc-induced tetrahedron Cage-t32-Zn1-HEHE-35 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k8i | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of designed zinc-induced tetrahedron Cage-t32-Zn1-HEHE-36 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
