Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9ubo
Status:HPUB -- hold until publication
Title:The structure of type III CRISPR-associated deaminase in complex cA6 and ATP, state 5
Authors:Kong, J.P., Wu, W.Q., Li, Z.X., Xiao, Y.B.
Deposition date:2025-04-03
PDBID:9nzm
Status:HPUB -- hold until publication
Title:Crystal Structure of Kirsten Rat Sarcoma G12C Complexed with GMPPNP and Covalently Bound to an Adduct of {(2S)-4-[7-(8-chloronaphthalen-1-yl)-2-{[(2S)-1-methylpyrrolidin-2-yl]methoxy}-5,6,7,8-tetrahydropyrido[3,4-d]pyrimidin-4-yl]-1-[(2Z)-2-fluoro-3-(pyridin-2-yl)prop-2-enoyl]piperazin-2-yl}acetonitrile
Authors:Sheriff, S., Pokross, M., Witmer, M.
Deposition date:2025-04-01
PDBID:9u8r
Status:HPUB -- hold until publication
Title:Crystal structure of thiamine pyrophosphate (TPP)-dependent alpha-imino acid decarboxylase (AzcB and AzcC) from Streptomyces mobaraensis in complex with TTPP and 6-amino-4-oxo-4,5-dihydro-1,3,5-triazine-2-carboxylic acid.
Authors:Nakashima, Y., Tsunoda, T., Ogasawara, Y., Dairi, T., Morita, H.
Deposition date:2025-03-26
PDBID:9u8s
Status:HPUB -- hold until publication
Title:Crystal structure of thiamine pyrophosphate (TPP)-dependent alpha-imino acid decarboxylase (AzcB and AzcC) from Streptomyces mobaraensis in complex with TPP and 5-azacytosine.
Authors:Nakashima, Y., Tsunoda, T., Ogasawara, Y., Dairi, T., Morita, H.
Deposition date:2025-03-26
PDBID:9qkb
Status:HPUB -- hold until publication
Title:NCS-1 bound to XChem ligand 5
Authors:Munoz-Reyes, D., Sanchez-Barrena, M.J.
Deposition date:2025-03-19
PDBID:9mc9
Status:HPUB -- hold until publication
Title:Cryo-EM structure of Human UBA1-UBE2O-Ub -Recruitment state 5
Authors:Chen, P.-T., Wu, K.-P.
Deposition date:2025-03-17
PDBID:9nt0
Status:HPUB -- hold until publication
Title:OXA-23-meropenem, pH 7.5
Authors:Smith, C.A., Toth, M., Stewart, N.K., Vakulenko, S.B.
Deposition date:2025-03-17
Sequence:

>Entity 1


MNKYFTCYVVASLFLSGCTVQHNLINETPSQIVQGHNQVIHQYFDEKNTSGVLVIQTDKKINLYGNALSRANTEYVPASTF(KCX)MLNALIGLENQKTDINEIFKWKGEKRSFTAWEKDMTLGEAMKLSAVPVYQELARRIGLDLMQKEVKRIGFGNAEIGQQVDNFWLVGPLKVTPIQEVEFVSQLAHTQLPFSEKVQANVKNMLLLEESNGYKIFGKTGWAMDIKPQVGWLTGWVEQPDGKIVAFALNMEMRSEMPASIRNELLMKSLKQLNII
PDBID:9nsw
Status:HPUB -- hold until publication
Title:apo-OXA-23, pH 7.5
Authors:Smith, C.A., Toth, M., Stewart, N.K., Vakulenko, S.B.
Deposition date:2025-03-17
Sequence:

>Entity 1


MNKYFTCYVVASLFLSGCTVQHNLINETPSQIVQGHNQVIHQYFDEKNTSGVLVIQTDKKINLYGNALSRANTEYVPASTF(KCX)MLNALIGLENQKTDINEIFKWKGEKRSFTAWEKDMTLGEAMKLSAVPVYQELARRIGLDLMQKEVKRIGFGNAEIGQQVDNFWLVGPLKVTPIQEVEFVSQLAHTQLPFSEKVQANVKNMLLLEESNGYKIFGKTGWAMDIKPQVGWLTGWVEQPDGKIVAFALNMEMRSEMPASIRNELLMKSLKQLNII
PDBID:9no1
Status:HOLD -- hold until a certain date
Title:Cryo-ET map of the VZV capsid vertex (5-fold axis).
Authors:Oliver, S.L., Chen, M.
Deposition date:2025-03-07
Release date:2026-03-07
PDBID:9qe2
Status:HPUB -- hold until publication
Title:Mouse otoferlin (216-1931) in complex with an MSP2N2 lipid nanodisc (30 mol% DOPS, 10 mol% PI(4,5)P2)
Authors:Cretu, C., Moser, T.
Deposition date:2025-03-07
PDBID:9qdd
Status:HOLD -- hold until a certain date
Title:Nitratidesulfovibrio vulgaris [FeFe]-hydrogenase crystallized in the sodium acetate buffer at pH 5.3
Authors:Bikbaev, K., Span, I.
Deposition date:2025-03-06
Release date:2025-04-03
PDBID:9qdg
Status:HOLD -- hold until a certain date
Title:Nitratidesulfovibrio vulgaris [FeFe] hydrogenase crystallized in the sodium propionate buffer at pH 5.0
Authors:Bikbaev, K., Span, I.
Deposition date:2025-03-06
Release date:2026-03-06
PDBID:9m61
Status:HPUB -- hold until publication
Title:Cryo-EM structure of 5-HT2BR in complex with RS127445
Authors:Zhong, Y.X., Guo, Q., Tao, Y.Y.
Deposition date:2025-03-06
PDBID:9m60
Status:HPUB -- hold until publication
Title:Cryo-EM structure of 5-HT2BR in complex with ritanseirn
Authors:Zhong, Y.X., Guo, Q., Tao, Y.Y.
Deposition date:2025-03-06
PDBID:9nlk
Status:AUTH -- processed, waiting for author review and approval
Title:[0,7,13,P-->14] Shifted tensegrity triangle with an (arm,center,arm) distribution of (0,7,13) base pairs, 1 nt sticky ends, and 5'' phosphates containing a semi-junction that becomes left-handed
Authors:Horvath, A., Vecchioni, S., Woloszyn, K., Ohayon, Y.P., Sha, R.
Deposition date:2025-03-03
PDBID:9nlu
Status:REPL -- author sent new coordinates, entry to be reprocessed
Title:Y20S (Sec18-Sec17-Sec9-Sso1-Snc1) EDTA - Class 5
Authors:Khan, Y.A., Brunger, A.T.
Deposition date:2025-03-03
PDBID:9nkt
Status:AUTH -- processed, waiting for author review and approval
Title:[0,8,12P-->13] Shifted tensegrity triangle with an (arm,center,arm) distribution of (0,8,12) base pairs, 1 nt sticky ends, and 5'' phosphates containing a semi-junction that becomes left-handed
Authors:Horvath, A., Vecchioni, S., Woloszyn, K., Ohayon, Y.P., Sha, R.
Deposition date:2025-03-01
PDBID:9m2l
Status:HPUB -- hold until publication
Title:Crystal structure of okaE in complex with a-ketoglutarate and okaramine A at 2.5 angstroms resolution.
Authors:Liu, T.H., Yan, W.P.
Deposition date:2025-02-27
PDBID:9nic
Status:HPUB -- hold until publication
Title:E.coli DsbA in complex with N-(2-amino-3-fluorophenyl)-5-methylisoxazole-3-carboxamide
Authors:Wang, G., Heras, B.
Deposition date:2025-02-26
PDBID:9q92
Status:AUTH -- processed, waiting for author review and approval
Title:CryoEM structure of bacterial transcription intermediate complex mediated by activator PspF containing nifH promoter DNA containing mismatch from -11 to -8 - conformation 5
Authors:Gao, F., Zhang, X.
Deposition date:2025-02-26
PDBID:9nhg
Status:HPUB -- hold until publication
Title:E.coli DsbA in complex with N-(2-aminophenyl)-5-methylisoxazole-3-carboxamide
Authors:Wang, G., Heras, B.
Deposition date:2025-02-24
PDBID:9q86
Status:HPUB -- hold until publication
Title:McCP in complex with photocaged nitric oxide, 1.44 s, 9.5 microjoule, SSX
Authors:Smyth, P., Williams, L.J., Hough, M.A., Worrall, J.A.R., Owen, R.L.
Deposition date:2025-02-22
PDBID:9nfn
Status:HPUB -- hold until publication
Title:Nanotube of Y5 - (5 protomer)
Authors:Das, A., Conticello, V.
Deposition date:2025-02-21
PDBID:9ifq
Status:HPUB -- hold until publication
Title:Unspecific peroxygenase from Psathyrella aberdarensis (PabUPO-II) in complex with 5-hydroxymethylfurfural
Authors:Fernandez-Garcia, A., Sanz-Aparicio, J.
Deposition date:2025-02-18
PDBID:9nd7
Status:HPUB -- hold until publication
Title:[T:Ag+/Hg2+:T--(pH8-pH9.5; 75s)] Metal-mediated DNA base pair in tensegrity triangle grown at pH 8 and soaked in pH 9.5 for 75s
Authors:Lu, B., Vecchioni, S.
Deposition date:2025-02-17

238582

數據於2025-07-09公開中

PDB statisticsPDBj update infoContact PDBjnumon