| PDBID: | 9mkc | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MALT1 in complex with an allosteric inhibitor | | Authors: | Bell, J.A. | | Deposition date: | 2024-12-17 |
|
| PDBID: | 9mkd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MALT1 in complex with an allosteric inhibitor | | Authors: | Bell, J.A. | | Deposition date: | 2024-12-17 |
|
| PDBID: | 9mke | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MALT1 in complex with an allosteric inhibitor | | Authors: | Bell, J.A. | | Deposition date: | 2024-12-17 |
|
| PDBID: | 9mkb | | Status: | HPUB -- hold until publication | | Title: | Structure of the bacteriophage T4 portal-neck-tail complex | | Authors: | Fokine, A., Zhu, J., Klose, T., Vago, F., Arnaud, C., Wang, Z., Khare, B., Rossmann, M.G., Chen, Z., Sun, L., Fang, Q., Kuhn, R., Rao, V.B. | | Deposition date: | 2024-12-17 |
|
| PDBID: | 9mkf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-17 |
|
| PDBID: | 9mkh | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Open state of D-ornithine 4,5-aminomutase from Fervidobacterium nodosum | | Authors: | Pham, K., Poore, A., Tian, S., Vago, F. | | Deposition date: | 2024-12-17 |
|
| PDBID: | 9mki | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Closed state of D-ornithine 4,5-aminomutase from Fervidobacterium nodosum | | Authors: | Pham, K., Tian, S. | | Deposition date: | 2024-12-17 |
|
| PDBID: | 9mkg | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-12-17 |
|
| PDBID: | 9mko | | Status: | HPUB -- hold until publication | | Title: | 4D4 TCR bound to R-phycoerythrin | | Authors: | Rashleigh, L., Gully, B.S., Rossjohn, J. | | Deposition date: | 2024-12-17 |
|
| PDBID: | 9mkn | | Status: | HPUB -- hold until publication | | Title: | Structure of the Respiratory Syncytial Virus Fusion Protein Bound to Human Antibodies RSV_2245 and RSV_3301 | | Authors: | Johnson, N.V., McLellan, J.S. | | Deposition date: | 2024-12-17 |
|
| PDBID: | 9mkk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-17 |
|
| PDBID: | 9mkl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-17 |
|
| PDBID: | 9hpz | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the wild-type flagellar filament from Roseburia hominis | | Authors: | Bell, M.E.W., Koch, I., Hipp, K., Hartmann, M.D., Merino, F., Ley, R.E. | | Deposition date: | 2024-12-16 | | Release date: | 2025-12-16 |
|
| PDBID: | 9hq8 | | Status: | HPUB -- hold until publication | | Title: | Hypothetical protein from ssRNA Leviviricetes sp bacteriophage metagenome, IMGVR_UViG_3300036404_000292 | | Authors: | Balta, I., Sisovs, M., Tars, K. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hpt | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of OXA-57 | | Authors: | Bragginton, E.C., Hinchliffe, P., Spencer, J. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hqo | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of bovine TMEM206-YFP purified and plunged using MISO (micro-purification) | | Authors: | De Gieter, S., Eluru, G., Schenck, S., Stroobants, A., Efremov, R.G., Brunner, J.D. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hpu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of OXA-57 | | Authors: | Shaw, J.M., Bragginton, E.C., Hinchliffe, P., Spencer, J. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hqp | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of mouse TMEM16F-YFP purified and plunged using MISO (microfluidic isolation) | | Authors: | De Gieter, S., Eluru, G., Schenck, S., Stroobants, A., Efremov, R.G., Brunner, J.D. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hpw | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of meropenem bound to OXA-57 | | Authors: | Bragginton, E.C., Hinchliffe, P., Spencer, J. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hpy | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of avibactam bound to OXA-57 | | Authors: | Bragginton, E.C., Hinchliffe, P., Spencer, J. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hqn | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of bovine TMEM206 | | Authors: | Brunner, J.D., Schenck, S., De Gieter, S. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hpq | | Status: | HPUB -- hold until publication | | Title: | Peptide-substrate-binding (PSB) domain of human type I collagen prolyl 4-hydroxylase complexed with Pro-Pro-Gly-Pro-Arg-Gly-Pro-Pro-Gly. | | Authors: | Sulu, R., Rahman, M.M., Wierenga, R.K., Koski, M.K. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hps | | Status: | HPUB -- hold until publication | | Title: | Human BclxLdeltaLT-VDAC1-N fusion protein complex structure | | Authors: | Janowski, R., Niessing, D. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hq0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hqf | | Status: | HPUB -- hold until publication | | Title: | SARM1 TIR domain in complex with compound 7-ADPR | | Authors: | Giroud, M., Kuhn, B., Steiner, S., Westwood, P., Mendel, M., Mani, A., Pinard, E., Haap, W., Grether, U., Caramenti, P., Rombach, D., Zambaldo, C., Ritter, M., Schmid, P., Gasser, C., Aregger, N., Sechet, N., Topp, A., Bilyard, M., Malnight-Alvarez, A., Plitzko, I., Hilbert, M., Kalayil, S., Burger, D., Bonardi, C., Saal, W., Haider, A., Wittwer, M., Brigo, A., Keaney, J., Benz, J. | | Deposition date: | 2024-12-16 | | Sequence: | >Entity 1
GGSSGSGDTPDVFISYRRNSGSQLASLLKVHLQLHGFSVFIDVEKLEAGKFEDKLIQSVMGARNFVLVLSPGALDKCMQDHDCKDWVHKEIVTALSCGKNIVPIIDGFEWPEPQVLPEDMQAVLTFNGIKWSHEYQEATIEKIIRFLQ
|
|
