| PDBID: | 9nyj | | Status: | HPUB -- hold until publication | | Title: | MoaC-pyranopterin [(alpha-beta-methyleno]triphosphate covalent complex in the absence of Mg2+ | | Authors: | Schumacher, M.A., Yokoyama, K. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9nyc | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the glycosyltransferase GtrB in the substrate-bound state | | Authors: | Morgan, R.T., Motta, S., Gil-Iturbe, E., Bhattacharjee, B., di Muccio, G., Romagnoli, A., Anwar, M.T., Mishra, B., Ashraf, K., Bang, I., di Marino, D., Lowary, T.L., Quick, M., Petrou, V.I., Stowell, M.H.B., Nygaard, R., Mancia, F. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9nym | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of an MKP5 allosteric loop mutant, N448A | | Authors: | Manjula, R., Bennett, A.M., Lolis, E. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9nyg | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | LmuABC-DNA | | Authors: | Chakravarti, A., Zhang, Z. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qpk | | Status: | HPUB -- hold until publication | | Title: | E.coli TalB mutant E96Q, F178Y, R300E | | Authors: | Soderholm, A., Roos, A., Widersten, M. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qph | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase in complex with Fe and IPN using tr-SFX | | Authors: | Rabe, P., Schofield, C.J., Stead, A. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qpi | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase in complex with Fe and ACV | | Authors: | Rabe, P., Schofield, C.J., Stead, A. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qpj | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase in complex with Fe and IPN using tr-SSX | | Authors: | Rabe, P., Schofield, C.J., Stead, A. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qpp | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of human MATa2 in complex with MAT2B isoform v1 at 2.6 A resolution | | Authors: | Khaja, F., Antonyuk, S.V., Muench, S.P., Hasnain, S.S. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qpo | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of human MATa2 in complex with MATBv2 at 2.6 A resolution | | Authors: | Khaja, F., Antonyuk, S.V., Muench, S.P., Hasnain, S.S. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qpd | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qpf | | Status: | HPUB -- hold until publication | | Title: | Solution structure of Sox2 DBD | | Authors: | Orsetti, A., van Ingen, H. | | Deposition date: | 2025-03-27 | | Sequence: | >Entity 1
GSNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTL
|
|
| PDBID: | 9nxu | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Glutathione S-Transferase Per a 22 | | Authors: | Zong, G., Pedersen, L.C., Mueller, G.A. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9nxt | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Glutathione S-Transferase Per a 21 | | Authors: | Zong, G., Pedersen, L.C., Mueller, G.A. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9ny7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the ribose operon repressor, RbsR, bound to ribose | | Authors: | Wells, M.L., Lu, C., Sultanov, D., Weber, K.C., Gong, Z., Glasgow, A. | | Deposition date: | 2025-03-26 | | Sequence: | >Entity 1
SATMKDVARLAGVSTSTVSHVINKDRFVSEAITAKVEAAIKELNYAPSALARSLKLNQTHTIGMLITASTNPFYSELVRGVERSCFERGYSLVLCNTEGDEQRMNRNLETLMQKRVDGLLLLCTETHQPSREIMQRYPTVPTVMMDWAPFDGDSDLIQDNSLLGGDLATQYLIDKGHTRIACITGPLDKTPARLRLEGYRAAMKRAGLNIPDGYEVTGDFEFNGGFDAMRQLLSHPLRPQAVFTGNDAMAVGVYQALYQAELQVPQDIAVIGYDDIELASFMTPPLTTIHQPKDELGELAIDVLIHRITQPTLQQQRLQLTPILMERGSA
|
|
| PDBID: | 9ny8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the ribose operon repressor, RbsR, bound to ribose operon | | Authors: | Wells, M.L., Lu, C., Sultanov, D., Weber, K.C., Gong, Z., Glasgow, A. | | Deposition date: | 2025-03-26 | | Sequence: | >Entity 1
SATMKDVARLAGVSTSTVSHVINKDRFVSEAITAKVEAAIKELNYAPSALARSLKLNQTHTIGMLITASTNPFYSELVRGVERSCFERGYSLVLCNTEGDEQRMNRNLETLMQKRVDGLLLLCTETHQPSREIMQRYPTVPTVMMDWAPFDGDSDLIQDNSLLGGDLATQYLIDKGHTRIACITGPLDKTPARLRLEGYRAAMKRAGLNIPDGYEVTGDFEFNGGFDAMRQLLSHPLRPQAVFTGNDAMAVGVYQALYQAELQVPQDIAVIGYDDIELASFMTPPLTTIHQPKDELGELAIDVLIHRITQPTLQQQRLQLTPILMERGSA
>Entity 2
(DG)(DT)(DG)(DG)(DG)(DT)(DC)(DA)(DG)(DC)(DG)(DA)(DA)(DA)(DC)(DG)(DT)(DT)(DT)(DC)(DG)(DC)(DT)(DG)(DA)(DT)(DG)(DG)(DA)(DG)
>Entity 3
(DC)(DT)(DC)(DC)(DA)(DT)(DC)(DA)(DG)(DC)(DG)(DA)(DA)(DA)(DC)(DG)(DT)(DT)(DT)(DC)(DG)(DC)(DT)(DG)(DA)(DC)(DC)(DC)(DA)(DC)
|
|
| PDBID: | 9ny1 | | Status: | HPUB -- hold until publication | | Title: | LmuA_conformation 2_assymetric | | Authors: | Chakravarti, A., Zhang, Z. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9ny5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | LmuABC_apo | | Authors: | Chakravarti, A., Zhang, Z. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9nxw | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Glutathione S-Transferase Bla g 22 | | Authors: | Zong, G., Pedersen, L.C., Mueller, G.A. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qoh | | Status: | HPUB -- hold until publication | | Title: | Mouse Ribosome POST translocation state | | Authors: | Santo, P.E., Astier, A., Plisson-Chastang, C. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qp8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Diels Alderase Cyc15b | | Authors: | Yang, S., Kisa, D., Basle, A., Race, P.R. | | Deposition date: | 2025-03-26 | | Release date: | 2026-03-26 |
|
| PDBID: | 9qoe | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-Id with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qog | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Affitin C10 in complex with a a double-helical aromatic oligoamide foldamer | | Authors: | Sigl, J.C., Sachs, J., Merlet, E., Ferrand, Y., Huc, I. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qp9 | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qoc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-26 |
|
