| PDBID: | 9feg | | Status: | HPUB -- hold until publication | | Title: | PARP15 in complex with a quinazolin-4-one inhibitor | | Authors: | Bosetti, C., Lehtio, L. | | Deposition date: | 2024-05-20 |
|
| PDBID: | 9bvy | | Status: | HPUB -- hold until publication | | Title: | Neutron Structure of Peroxide-Soaked Tyr34Phe MnSOD | | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | | Deposition date: | 2024-05-20 | | Sequence: | >Entity 1
MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
| PDBID: | 9bvz | | Status: | HOLD -- hold until a certain date | | Title: | SARS-CoV-2 main protease bound to inhibitor AR-A-135 | | Authors: | Liu, W.R., Blankenship, L.R. | | Deposition date: | 2024-05-20 | | Release date: | 2025-05-20 |
|
| PDBID: | 9bw2 | | Status: | HPUB -- hold until publication | | Title: | Neutron Structure of Reduced Tyr34Phe MnSOD | | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | | Deposition date: | 2024-05-20 | | Sequence: | >Entity 1
MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
| PDBID: | 9bw3 | | Status: | HPUB -- hold until publication | | Title: | Consensus model for preturnover condition of Bacillus subtilis ribonucleotide reductase complex | | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | | Deposition date: | 2024-05-20 |
|
| PDBID: | 8zlf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of DH domain of FYVE Domain containing protein(FP10) from Entamoeba histolytica | | Authors: | Gautam, A.K., Umarao, P., Gourinath, S. | | Deposition date: | 2024-05-19 |
|
| PDBID: | 9bv4 | | Status: | HPUB -- hold until publication | | Title: | NMR Solution Structure of Excelsatoxin A in DPC micelles | | Authors: | Saipriyaa, P.V., Chin, Y.K., Mehdi, M. | | Deposition date: | 2024-05-19 |
|
| PDBID: | 9fed | | Status: | HPUB -- hold until publication | | Title: | Single-chain chimeric protein mimicking the interaction between HR1 and HR2 in HIV gp41 | | Authors: | Camara-Artigas, A., Gavira, J.A., Conejero-Lara, F., Polo-Megias, D. | | Deposition date: | 2024-05-18 |
|
| PDBID: | 8zlc | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Ankyrin Repeat Protein from Plasmodium falciparum | | Authors: | Kumari, P., Gautam, A.K., Gourinath, S., Malhotra, P. | | Deposition date: | 2024-05-18 |
|
| PDBID: | 9fdt | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human Sirt2 in complex with a pyrazole-based fragment inhibitor | | Authors: | Friedrich, F., Einsle, O., Jung, M. | | Deposition date: | 2024-05-17 |
|
| PDBID: | 9fdz | | Status: | HPUB -- hold until publication | | Title: | Single particle cryo-EM structure of the multidrug efflux pump OqxB from Klebsiella pneumoniae | | Authors: | Lazarova, M., Frangakis, A., Pos, K.M. | | Deposition date: | 2024-05-17 |
|
| PDBID: | 9fdp | | Status: | HPUB -- hold until publication | | Title: | Single particle cryo-EM structure of the AcrB V612W monomer in the O state | | Authors: | Lazarova, M., Boernsen, C., Frangakis, A., Pos, K.M. | | Deposition date: | 2024-05-17 |
|
| PDBID: | 9fdq | | Status: | HPUB -- hold until publication | | Title: | Single particle cryo-EM structure of the AcrB V612F monomer in the O state | | Authors: | Lazarova, M., Frangakis, A., Pos, K.M. | | Deposition date: | 2024-05-17 |
|
| PDBID: | 9fdu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human Sirt2 in complex with a pyridine-3-carbothioamide-based fragment inhibitor | | Authors: | Friedrich, F., Einsle, O., Jung, M. | | Deposition date: | 2024-05-17 |
|
| PDBID: | 9fdw | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human Sirt2 in complex with a 3-chlorobenzamide-based fragment inhibitor | | Authors: | Friedrich, F., Einsle, O., Jung, M. | | Deposition date: | 2024-05-17 |
|
| PDBID: | 9fdh | | Status: | HPUB -- hold until publication | | Title: | Closed Human phosphoglycerate kinase complex with BPG and ADP produced by cross-soaking a TSA crystal | | Authors: | Cliff, M.J., Waltho, J.P., Bowler, M.W., Baxter, N.J., Bisson, C., Blackburn, G.M. | | Deposition date: | 2024-05-17 |
|
| PDBID: | 9fdn | | Status: | HPUB -- hold until publication | | Title: | Human phosphoglycerate kinase in complex with ATP and 3PG formed by cross-soaking a TSA crystal | | Authors: | Cliff, M.J., Waltho, J.P., Bowler, M.W., Baxter, N.J., Bisson, C., Blackburn, G.M. | | Deposition date: | 2024-05-17 |
|
| PDBID: | 9fd8 | | Status: | HPUB -- hold until publication | | Title: | Re-engineered peroxygenase variant of 2-deoxy-D-ribose-5-phosphate aldolase, Schiff-base complex with 4-chloro-cinnamaldehyde | | Authors: | Thunnissen, A.M.W.H., Zhou, H., Frietema, H.O.T., Poelarends, G.J. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fd9 | | Status: | HPUB -- hold until publication | | Title: | Re-engineered peroxygenase variant of 2-deoxy-D-ribose-5-phosphate aldolase, Schiff-base complex with 4-nitro-cinnamaldehyde | | Authors: | Thunnissen, A.M.W.H., Zhou, H., Frietema, H.O.T., Poelarends, G.J. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fd7 | | Status: | HPUB -- hold until publication | | Title: | Re-engineered peroxygenase variant of 2-deoxy-D-ribose-5-phosphate aldolase in substrate-free state | | Authors: | Thunnissen, A.M.W.H., Zhou, H., Frietema, H.O.T., Poelarends, G.J. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fdb | | Status: | HPUB -- hold until publication | | Title: | Co-crystal structure of Galectin-3 with an inhibitor | | Authors: | Mac Sweeney, A. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9bu4 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of an MKP5 mutant, Y435W, in complex with an allosteric inhibitor | | Authors: | Manjula, R., Bennett, A.M., Lolis, E. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fc6 | | Status: | HPUB -- hold until publication | | Title: | HEN EGG-WHITE Lysozyme incubated at 87% relative humidity | | Authors: | Reinke, P.Y.A., Guenther, S., Falke, S., Galchenkova, M., Rahmani Mashhour, A., Creon, A., Lieske, J., Ewert, W., Rorigues, A.C., Thekku Veedu, S., Fischer, P., Meents, A. | | Deposition date: | 2024-05-15 |
|
| PDBID: | 9fc7 | | Status: | HPUB -- hold until publication | | Title: | HEN EGG-WHITE Lysozyme incubated at 99% relative humidity | | Authors: | Reinke, P.Y.A., Guenther, S., Falke, S., Galchenkova, M., Rahmani Mashhour, A., Creon, A., Lieske, J., Ewert, W., Rorigues, A.C., Thekku Veedu, S., Fischer, P., Meents, A. | | Deposition date: | 2024-05-15 |
|
| PDBID: | 9fc8 | | Status: | HPUB -- hold until publication | | Title: | HEN EGG-WHITE Lysozyme incubated at 60% relative humidity | | Authors: | Reinke, P.Y.A., Guenther, S., Falke, S., Galchenkova, M., Rahmani Mashhour, A., Creon, A., Lieske, J., Ewert, W., Rorigues, A.C., Thekku Veedu, S., Fischer, P., Meents, A. | | Deposition date: | 2024-05-15 |
|
