| PDBID: | 9l5p | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9l5n | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9l5v | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9l5q | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9l5o | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the mutant Y549A of collagenase VhaC | | Authors: | Zhao, W.X. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9l52 | | Status: | HPUB -- hold until publication | | Title: | The ring expansion oxygenase SpoC in complex with Fe and stipitaldehyde | | Authors: | Liu, M., He, X. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9l5x | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of Klebsiella pneumoniae Enoyl-Acyl Carrier Protein Reductase (FabI) in complex with Triclosan | | Authors: | Biswas, S., Patra, A., Kushwaha, G.S., Suar, M. | | Deposition date: | 2024-12-23 | | Release date: | 2025-12-23 |
|
| PDBID: | 9l5y | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9l5w | | Status: | HPUB -- hold until publication | | Title: | FADD-DED filaments coordinate complex IIa assembly during TNF-induced apoptosis | | Authors: | Tan, Y.B., Luo, D. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9l61 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of BRD2 BD2 domain in complex with small molecule inhibitor Mivebresib ABBV-075 | | Authors: | Jwala, N., Vijayshankar, N., Thomas, A., NarasimhaRao, K. | | Deposition date: | 2024-12-23 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPD
|
|
| PDBID: | 7ht8 | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z363071686 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7ht9 | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z369263636 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7hta | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z384361454 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7htb | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z385450668 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7htc | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z404993336 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7htd | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z405825414 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7hte | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z409022580 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7htf | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z419995480 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7htg | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z422344882 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7hth | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z445186088 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7hti | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z44585777 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7htj | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z44592329 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7htk | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z45705015 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7htl | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z50145861 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7htm | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z53825479 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
