| PDBID: | 9pq8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of DND1-NANOS3-RNA complex | | Authors: | Qiu, C., Hall, T.M.T. | | Deposition date: | 2025-07-22 |
|
| PDBID: | 9pnn | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of J601-A6 Fab in complex with HIV-1 BG505 DS-SOSIP Env trimer | | Authors: | Wang, S., Zhou, T., Kwong, P.D., Morano, N.C., Shapiro, L. | | Deposition date: | 2025-07-21 |
|
| PDBID: | 9pnu | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of K001-A1 Fab in complex with HIV-1 459C-OPT RnS DS-SOSIP Env trimer | | Authors: | Wang, S., Zhou, T., Kwong, P.D., Morano, N.C., Shapiro, L. | | Deposition date: | 2025-07-21 |
|
| PDBID: | 9ppl | | Status: | HPUB -- hold until publication | | Title: | Structure of STING in complex with MK-2118 | | Authors: | Lesburg, C.A., Henderson, T., Ho, T., Hayes, R.P., Bennett, J. | | Deposition date: | 2025-07-21 |
|
| PDBID: | 9s1s | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of C278S mutant of mouse CDC14A in complex with a model phosphopeptide | | Authors: | Shabbir, K., Jackisch, G., Sele, C., Murina, V., Knecht, W., Wilson, E., Dong, L., Friedman, T.B., Imtiaz, A., Logan, D.T. | | Deposition date: | 2025-07-21 | | Sequence: | >Entity 1
AAESGELIGACEFMKDRLYFATLRNRPKSTINIHYFSIDEELVYENFYADFGPLNLAMVYRYCCKLNKKLKSYSLSRKKIVHYTSFDQRKRANAAFLIGAYAVIYLKKTPEEAYRALLSGSNPPYLPFRDASFGNCTYNLTVLDCLQGIRKGLQHGFFDFETFDAEEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGYPLHAPEAYFPYFKKNNVTTIVRLNKKIYEAKRFTDAGFEHYDLFFIDGSTPSDNIVRRFLNICENTEGAIAVHSKAGLGRTGTLIACYVMKHYRFTHAEIIAWIRICRPGSIIGPQQHFLKEKQASLWVQGDIFRSKLKNR
>Entity 2
A(SEP)PRRR
|
|
| PDBID: | 9pn4 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of a three finger toxin from snake venom | | Authors: | Jobichen, C., Christabel, C.Y.L., Sivaraman, J., Kini, R.M. | | Deposition date: | 2025-07-19 | | Release date: | 2026-07-19 |
|
| PDBID: | 9pmm | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of C. elegans PUF-3 in complex with RNA I-1 | | Authors: | Zhang, Y., Hall, T.M.T. | | Deposition date: | 2025-07-18 |
|
| PDBID: | 9pn1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Q108K:K40L:T51V:T53C:R58W:T29L:Y19W:Q4A mutant of cellular retinol binding protein II complex with 15-cis-retinal | | Authors: | Ehyaei, N., Silva, K., Bingham, C., Geiger, J.H., Borhan, B. | | Deposition date: | 2025-07-18 | | Sequence: | >Entity 1
TRDANGTWEMESNENFEGWMKALDIDFALRKIAVRLTQTLVIDQDGDNFKVKCTSTFWNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKKWIEGDKLYLELTCGDQVCRQVFKKK
|
|
| PDBID: | 9vxe | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of NapIM_type1 amyloid beta 42 fibril. | | Authors: | Zhao, Q.Y., Cui, B.Y., Liu, C. | | Deposition date: | 2025-07-18 |
|
| PDBID: | 9s1j | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase Q280A and L282A variant in complex with Fe and ACV under anaerobic conditions. | | Authors: | Jabbary, M., Rabe, P., Schofield, C.J. | | Deposition date: | 2025-07-18 |
|
| PDBID: | 9s1k | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase S281A variant in complex with Fe and ACV under anaerobic conditions. | | Authors: | Jabbary, M., Rabe, P., Schofield, C.J. | | Deposition date: | 2025-07-18 |
|
| PDBID: | 9vw8 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of E.coli transcription initiation complex with Escherichia phage Mu late transcription activator C using the PI promoter DNA | | Authors: | Lin, W. | | Deposition date: | 2025-07-16 |
|
| PDBID: | 9s0m | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SARS-CoV-2 NSP14 in complex with compound 1 | | Authors: | Georgiou, I., Robinson, C., OByrne, S., Matsuda, A., Grygier, P., Smith, C., ONeill, S., Ahmad, S., Post, J., Groenewold, G.J.M., Urakova, N., Wanningen, P., Kresik, L., Plewka, J., Delpal, A., See, K., Eadsforth, T., Paul, M., Lis, K., Decroly, E., Singh Saikatendu, K., Chang, E., Snijder, E.J., Czarna, A., Pyrc, K., Scott, D., Gilbert, I. | | Deposition date: | 2025-07-16 |
|
| PDBID: | 9rze | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | State 2 MAP 3 RNA Pol II activated elongation complex with SETD2 bound to proximal upstream H3 | | Authors: | Walshe, J.L., Ochmann, M., Dienemann, C., Cramer, P. | | Deposition date: | 2025-07-15 |
|
| PDBID: | 9ryj | | Status: | HOLD -- hold until a certain date | | Title: | Aquifex aeolicus lumazine synthase 11-pentamer cage in complex with C5-symmetrized riboflavin synthase C-termini | | Authors: | Koziej, L., Azuma, Y. | | Deposition date: | 2025-07-15 | | Release date: | 2026-07-15 |
|
| PDBID: | 9ryh | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SARS-CoV-2 NSP3 Macrodomain in complex with SRI1.66 at room temperature | | Authors: | Lambert, M.C., Aledavood, E., Born, J., Fairhead, M., Gil, C., Koekemoer, L., Martinez, A., Mikolajek, H., Ramos, S., Sanchez-Weatherby, J., Sandy, J., Thompson, A.J., von Delft, F., Walsh, M., Wang, S., Williams, E.P., Hough, M.A. | | Deposition date: | 2025-07-15 |
|
| PDBID: | 9ryt | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SARS-CoV-2 NSP3 Macrodomain in complex with SRI1.97 at room temperature | | Authors: | Lambert, M.C., Aledavood, E., Born, J., Fairhead, M., Gil, C., Koekemoer, L., Martinez, A., Mikolajek, H., Ramos, S., Sanchez-Weatherby, J., Sandy, J., Thompson, A.J., von Delft, F., Walsh, M., Wang, S., Williams, E.P., Hough, M.A. | | Deposition date: | 2025-07-15 |
|
| PDBID: | 9rzb | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SARS-CoV-2 NSP3 Macrodomain in complex with SRI1.112 at room temperature | | Authors: | Lambert, M.C., Aledavood, E., Born, J., Fairhead, M., Gil, C., Koekemoer, L., Martinez, A., Mikolajek, H., Ramos, S., Sanchez-Weatherby, J., Sandy, J., Thompson, A.J., von Delft, F., Walsh, M., Wang, S., Williams, E.P., Hough, M.A. | | Deposition date: | 2025-07-15 |
|
| PDBID: | 9rzi | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Amborella trichopoda ACCO2 in complex with Fe and ACC | | Authors: | Zhang, Z., Schofield, C.J. | | Deposition date: | 2025-07-15 |
|
| PDBID: | 9rzk | | Status: | HPUB -- hold until publication | | Title: | RAPTA-6MB (Ruthenium[II]-hexamethylbenzene-phosphaadamantane) cancer drug binding to the nucleosome core | | Authors: | Adhireksan, Z., Davey, C.A. | | Deposition date: | 2025-07-15 |
|
| PDBID: | 9rzn | | Status: | HPUB -- hold until publication | | Title: | RAPTA-3IB (Ruthenium[II]-1,3,5-triisopropylbenzene-phosphaadamantane) cancer drug binding to the nucleosome core | | Authors: | Adhireksan, Z., Davey, C.A. | | Deposition date: | 2025-07-15 |
|
| PDBID: | 9pjf | | Status: | HPUB -- hold until publication | | Title: | GII.4 Human Norovirus 3CL protease bound to compound 27 | | Authors: | Campbell, A.C., Opel-Reading, H.K., Krause, K.L. | | Deposition date: | 2025-07-14 |
|
| PDBID: | 9ry6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SARS-CoV-2 NSP3 Macrodomain in complex with SRI1.65 at room temperature | | Authors: | Lambert, M.C., Aledavood, E., Born, J., Fairhead, M., Gil, C., Koekemoer, L., Martinez, A., Mikolajek, H., Ramos, S., Sanchez-Weatherby, J., Sandy, J., Thompson, A.J., von Delft, F., Walsh, M., Wang, S., Williams, E.P., Hough, M.A. | | Deposition date: | 2025-07-14 |
|
| PDBID: | 9ry3 | | Status: | HPUB -- hold until publication | | Title: | RAPTA-B (Ruthenium[II]-benzene-phosphaadamantane) cancer drug binding to the nucleosome core | | Authors: | Adhireksan, Z., Davey, C.A. | | Deposition date: | 2025-07-14 |
|
| PDBID: | 9rya | | Status: | HPUB -- hold until publication | | Title: | RAPTA-3MB (Ruthenium[II]-1,3,5-trimethylbenzene-phosphaadamantane) cancer drug binding to the nucleosome core | | Authors: | Adhireksan, Z., Davey, C.A. | | Deposition date: | 2025-07-14 |
|
