PDBID: | 8yuf | Status: | HPUB -- hold until publication | Title: | Crystal structure of HEPN (Q64A) toxin | Authors: | Jin, C., Jeon, C., Kim, D.H., Lee, B.J. | Deposition date: | 2024-03-27 |
|
PDBID: | 9b7a | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of peroxiredoxin 1 with RA | Authors: | Wu, Y., Xu, H., Luo, C. | Deposition date: | 2024-03-27 |
|
PDBID: | 9etx | Status: | HPUB -- hold until publication | Title: | KEAP1 BTB in complex with compound 23 | Authors: | Richardson, W., Bullock, A.N., Rothweiler, E.M., Manning, C.E., Sweeney, M.N., Chalk, R., Huber, K.V.M. | Deposition date: | 2024-03-27 |
|
PDBID: | 9etc | Status: | HPUB -- hold until publication | Title: | Crystal structure of recombinant chicken liver Bile Acid Binding Protein (cL-BABP) in complex with chenodeoxycholic acid | Authors: | Tassone, G., Pozzi, C. | Deposition date: | 2024-03-26 | Sequence: | >Entity 1 GSHMAFSGTWQVYAQENYEEFLKALALPEDLIKMARDIKPIVEIQQKGDDFVVTSKTPRQTVTNSFTLGKEADITTMDGKKLKCTVHLANGKLVTKSEKFSHEQEVKGNEMVETITFGGVTLIRRSKRV
|
|
PDBID: | 8ytt | Status: | HPUB -- hold until publication | Title: | Structure of cyclohexanone monooxygenase mutant from Acinetobacter calcoaceticus | Authors: | Qiang, G., Zheng, Y.C., Feng, L., Yu, H.L. | Deposition date: | 2024-03-26 |
|
PDBID: | 8yu0 | Status: | HPUB -- hold until publication | Title: | Structure of cyclohexanone monooxygenase mutant from Acinetobacter calcoaceticus | Authors: | Qiang, G., Zheng, Y.C., Feng, L., Yu, H.L. | Deposition date: | 2024-03-26 |
|
PDBID: | 8yu2 | Status: | HPUB -- hold until publication | Title: | Structure of cyclohexanone monooxygenase mutant from Acinetobacter calcoaceticus | Authors: | Qiang, G., Zheng, Y.C., Feng, L., Yu, H.L. | Deposition date: | 2024-03-26 |
|
PDBID: | 8yu4 | Status: | HPUB -- hold until publication | Title: | Structure of cyclohexanone monooxygenase mutant from Acinetobacter calcoaceticus | Authors: | Qiang, G., Zheng, Y.C., Feng, L., Yu, H.L. | Deposition date: | 2024-03-26 |
|
PDBID: | 9etd | Status: | HPUB -- hold until publication | Title: | Crystal structure of recombinant chicken liver Bile Acid Binding Protein (cL-BABP) in complex with ursodeoxycholic acid | Authors: | Tassone, G., Pozzi, C. | Deposition date: | 2024-03-26 | Sequence: | >Entity 1 GSHMAFSGTWQVYAQENYEEFLKALALPEDLIKMARDIKPIVEIQQKGDDFVVTSKTPRQTVTNSFTLGKEADITTMDGKKLKCTVHLANGKLVTKSEKFSHEQEVKGNEMVETITFGGVTLIRRSKRV
|
|
PDBID: | 9ete | Status: | HPUB -- hold until publication | Title: | Crystal structure of recombinant chicken liver Bile Acid Binding Protein (cL-BABP) in complex with deoxycholic acid | Authors: | Tassone, G., Pozzi, C. | Deposition date: | 2024-03-26 | Sequence: | >Entity 1 GSHMAFSGTWQVYAQENYEEFLKALALPEDLIKMARDIKPIVEIQQKGDDFVVTSKTPRQTVTNSFTLGKEADITTMDGKKLKCTVHLANGKLVTKSEKFSHEQEVKGNEMVETITFGGVTLIRRSKRV
|
|
PDBID: | 9etf | Status: | HPUB -- hold until publication | Title: | Crystal structure of recombinant chicken liver Bile Acid Binding Protein (cL-BABP) in complex with lithocholic acid | Authors: | Tassone, G., Pozzi, C. | Deposition date: | 2024-03-26 | Sequence: | >Entity 1 GSHMAFSGTWQVYAQENYEEFLKALALPEDLIKMARDIKPIVEIQQKGDDFVVTSKTPRQTVTNSFTLGKEADITTMDGKKLKCTVHLANGKLVTKSEKFSHEQEVKGNEMVETITFGGVTLIRRSKRV
|
|
PDBID: | 9etg | Status: | HPUB -- hold until publication | Title: | Crystal structure of recombinant chicken liver Bile Acid Binding Protein (cL-BABP) in complex with CA-M11 | Authors: | Tassone, G., Pozzi, C., Maramai, S. | Deposition date: | 2024-03-26 | Sequence: | >Entity 1 GSHMAFSGTWQVYAQENYEEFLKALALPEDLIKMARDIKPIVEIQQKGDDFVVTSKTPRQTVTNSFTLGKEADITTMDGKKLKCTVHLANGKLVTKSEKFSHEQEVKGNEMVETITFGGVTLIRRSKRV
|
|
PDBID: | 8yt7 | Status: | HPUB -- hold until publication | Title: | Crystal structure of the MAM domain of Spodoptera frugiperda Scavenger Receptor-C | Authors: | Lan, J., Wang, C.H. | Deposition date: | 2024-03-25 |
|
PDBID: | 9b6c | Status: | HPUB -- hold until publication | Title: | Human asparagine synthetase Arg-142 to Ile-142 (R142I) variant | Authors: | Coricello, A., Nardone, A., Lupia, A., Gratteri, C., Vos, M., Chaptal, V., Alcaro, S., Zhu, W., Takagi, Y., Richards, N. | Deposition date: | 2024-03-25 |
|
PDBID: | 9ers | Status: | HPUB -- hold until publication | Title: | Hydrogenase-2 Ni-C state | Authors: | Wong, K.L., Carr, S.B., Ash, P.A., Vincent, K.A. | Deposition date: | 2024-03-25 |
|
PDBID: | 9b6b | Status: | HPUB -- hold until publication | Title: | Vpb4Aa2 pore complex in C7 symmetry | Authors: | Wirawan, R., Spicer, B.A., Bayly-Jones, C.J., Lupton, C., Venugopal, H., Berry, C., Dunstone, M. | Deposition date: | 2024-03-24 |
|
PDBID: | 8ysw | Status: | HPUB -- hold until publication | Title: | phosphinothricin dehydrogenase | Authors: | Xue, Y.P., Cheng, F., Zhou, S.P., Xu, J.M., Jin, L.Q., Ma, C.J., Zheng, Y.G. | Deposition date: | 2024-03-23 |
|
PDBID: | 8ys1 | Status: | HPUB -- hold until publication | Title: | Crystal structure of rat thioredoxin, Wild-type | Authors: | Baba, T., Ueno, G., Ohe, C., Saji, S., Yamamoto, S., Yamamoto, M., Ouchida, M., Kawasaki-Ohmori, I., Takeshita, K. | Deposition date: | 2024-03-22 |
|
PDBID: | 8ys3 | Status: | HPUB -- hold until publication | Title: | Crystal structure of rat thioredoxin, F54L mutant | Authors: | Takeshita, K., Baba, T., Ohe, C., Saji, S., Yamamoto, S., Yamamoto, M., Ouchida, M., Kawasaki-Ohmori, I. | Deposition date: | 2024-03-22 |
|
PDBID: | 8yrb | Status: | HPUB -- hold until publication | Title: | Structure of cyclohexanone monooxygenase mutant from Acinetobacter calcoaceticus | Authors: | Qiang, G., Zheng, Y.C., Feng, L., Yu, H.L. | Deposition date: | 2024-03-21 |
|
PDBID: | 9b3s | Status: | HPUB -- hold until publication | Title: | Crystal structure of casein kinase 1 delta 1 with tethered phosphorylated tail | Authors: | Harold, R.L., Yaitanes, N., Tripathi, S.T., Partch, C.L. | Deposition date: | 2024-03-20 |
|
PDBID: | 9b4b | Status: | HPUB -- hold until publication | Title: | DNA Ligase 1 E346A/E592A double mutant with 3''ribo-8oxoG:C nick | Authors: | KanalElamparithi, B., Caglayan, M. | Deposition date: | 2024-03-20 |
|
PDBID: | 9b4d | Status: | HPUB -- hold until publication | Title: | DNA Ligase 1 E346A/E592A double mutant with 3''deoxyribo-8oxoG:C nick | Authors: | KanalElamparithi, B., Caglayan, M. | Deposition date: | 2024-03-20 |
|
PDBID: | 8yqo | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM structure of human lanosterol 14alpha-demethylase (CYP51) in complex with FLZ | Authors: | Zhou, L.C. | Deposition date: | 2024-03-19 | Release date: | 2025-03-19 |
|
PDBID: | 8yqd | Status: | HPUB -- hold until publication | Title: | Crystal structure of human transthyretin variant A97S in complex with Tafamidis | Authors: | Tzeng, S.R., Huang, C.H., Wang, Y.S., Hsieh, M.F. | Deposition date: | 2024-03-19 |
|