Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9l5w
Status:HPUB -- hold until publication
Title:FADD-DED filaments coordinate complex IIa assembly during TNF-induced apoptosis
Authors:Tan, Y.B., Luo, D.
Deposition date:2024-12-23
PDBID:7htz
Status:HPUB -- hold until publication
Title:PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z69092635
Authors:Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F.
Deposition date:2024-12-23
PDBID:9mnp
Status:HPUB -- hold until publication
Title:Crystal structure of mutant variant of mAb CV3-25 Fab in complex with SARS-CoV-2 spike stem helix peptide
Authors:Chandravanshi, M., Tolbert, W.D., Pazgier, M.
Deposition date:2024-12-23
PDBID:9l4q
Status:HPUB -- hold until publication
Title:Crystal structure of the carbamoyl N-methyltransferase Asc-Orf2 complexed with SAH
Authors:Li, Z.Y., Zhu, D.Y., Shen, Y.M.
Deposition date:2024-12-20
PDBID:9mmp
Status:HPUB -- hold until publication
Title:Cryo-EM structure of CRAF/MEK1/14-3-3 complex (autoinhibited conformation)
Authors:Jang, D.M., Jeon, H., Eck, M.J.
Deposition date:2024-12-20
PDBID:9mmr
Status:HPUB -- hold until publication
Title:Cryo-EM structure of CRAF/MEK1/14-3-3 complex (open monomer conformation, CRAF Y340D/Y341D mutant)
Authors:Jang, D.M., Jeon, H., Eck, M.J.
Deposition date:2024-12-20
PDBID:9mmq
Status:HPUB -- hold until publication
Title:Cryo-EM structure of CRAF/MEK1 complex (kinase domain)
Authors:Jang, D.M., Jeon, H., Eck, M.J.
Deposition date:2024-12-20
PDBID:9mms
Status:HPUB -- hold until publication
Title:Cryo-EM structure of CRAF/MEK1 complex (kinase domain, CRAF Y340D/Y341D mutant)
Authors:Jang, D.M., Jeon, H., Eck, M.J.
Deposition date:2024-12-20
PDBID:9mlj
Status:HPUB -- hold until publication
Title:X-ray structure of SARS-CoV-2 main protease covalently bound to compound GRL-050-23 at 1.6 A
Authors:Beechboard, S.N., Mesecar, A.D., Ghosh, A.K., Center for Structural Biology of Infectious Diseases (CSBID)
Deposition date:2024-12-19
Sequence:

>Entity 1


SGFRKMAFPSGKVEGCMVQVT(CSO)GTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYD(CSO)VSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ
PDBID:9ht7
Status:WAIT -- processing started, waiting for author input to continue processing
Title:Structure of WT E.coli ribosome with complexed filament nascent chain at length 47, with P-site and A-site tRNAs
Authors:Mitropoulou, A., Wlodarski, T., Plessa, E., Cabrita, L.D., Christodoulou, J.
Deposition date:2024-12-19
PDBID:9mlx
Status:AUTH -- processed, waiting for author review and approval
Title:Crosslinked complex of ketosynthase FabB mutant FabBG107M and acyl carrier protein AcpP from E.coli with C12 crosslinker
Authors:Jiang, Z., Sankaran, B., Burkart, M.D., Fox, J.M.
Deposition date:2024-12-19
PDBID:9mle
Status:HPUB -- hold until publication
Title:Crystal structure of Asp49 Phospholipase A2 isolated from Lachesis muta
Authors:Leonardo, D.A., Vargas, J.A., Pereira, H.M., Garratt, R.C.
Deposition date:2024-12-19
PDBID:9mkv
Status:HPUB -- hold until publication
Title:FnoCas12a bridge helix variant state 3
Authors:Ganguly, C., Thomas, L.M., Aribam, S.D., Martin, L., Rajan, R.
Deposition date:2024-12-18
PDBID:9hs5
Status:WAIT -- processing started, waiting for author input to continue processing
Title:Cryo-EM structure of an agonist bound to the active melanocortin-4 receptor (MC4R) in complex with the heterotrimeric Gs protein at 3.06 A resolution.
Authors:Heyder, N.A., Speck, D., Schmidt, A., Hilal, T., Scheerer, P.
Deposition date:2024-12-18
PDBID:9mkx
Status:HPUB -- hold until publication
Title:FnoCas12a bridge helix variant state 4b
Authors:Ganguly, C., Thomas, L.M., Aribam, S.D., Martin, L., Rajan, R.
Deposition date:2024-12-18
PDBID:9hr7
Status:WAIT -- processing started, waiting for author input to continue processing
Title:Cryo-EM structure of an endogenous agonist bound to the active melanocortin-4 receptor (MC4R) in complex with the heterotrimeric Gs protein at 2.65 A resolution.
Authors:Heyder, N.A., Speck, D., Schmidt, A., Hilal, T., Scheerer, P.
Deposition date:2024-12-17
PDBID:9hr8
Status:WAIT -- processing started, waiting for author input to continue processing
Title:Cryo-EM structure of the synthetic high-affinity agonist bound to the active melanocortin-4 receptor (MC4R) in complex with the heterotrimeric Gs protein at 2.66 A resolution.
Authors:Heyder, N.A., Speck, D., Schmidt, A., Hilal, T., Scheerer, P.
Deposition date:2024-12-17
PDBID:9l2o
Status:HPUB -- hold until publication
Title:Cryo-EM structure and rational engineering of a novel efficient ochratoxin A-detoxifying amidohydrolase
Authors:Dai, L.H., Xu, Y.H., Hu, Y.M., He, B.Y., Huang, J.P., Xie, Z.Z., Li, H., Niu, D., Guo, R.-T., Chen, C.-C.
Deposition date:2024-12-17
PDBID:9l2t
Status:HPUB -- hold until publication
Title:Cryo-electron microscopic structure of a novel amidohydrolase with three mutations
Authors:Dai, L.H., Xu, Y.H., Hu, Y.M., He, B.Y., Huang, J.P., Xie, Z.Z., Li, H., Niu, D., Guo, R.-T., Chen, C.-C.
Deposition date:2024-12-17
PDBID:9l36
Status:AUTH -- processed, waiting for author review and approval
Title:Cryo-electron microscopic structure of a novel amidohydrolase ADH3 triple mutation
Authors:Dai, L.H., He, B.Y., Hu, Y.M., Xu, Y.H., Huang, J.P., Xie, Z.Z., Li, H., Niu, D., Guo, R.-T., Chen, C.-C.
Deposition date:2024-12-17
PDBID:9mkh
Status:AUTH -- processed, waiting for author review and approval
Title:Open state of D-ornithine 4,5-aminomutase from Fervidobacterium nodosum
Authors:Pham, K., Poore, A., Tian, S., Vago, F.
Deposition date:2024-12-17
PDBID:9mki
Status:AUTH -- processed, waiting for author review and approval
Title:Closed state of D-ornithine 4,5-aminomutase from Fervidobacterium nodosum
Authors:Pham, K., Tian, S.
Deposition date:2024-12-17
PDBID:9hpz
Status:AUTH -- processed, waiting for author review and approval
Title:Cryo-EM structure of the wild-type flagellar filament from Roseburia hominis
Authors:Bell, M.E.W., Koch, I., Hipp, K., Hartmann, M.D., Merino, F., Ley, R.E.
Deposition date:2024-12-16
Release date:2025-12-16
PDBID:9hqp
Status:HPUB -- hold until publication
Title:Cryo-EM structure of mouse TMEM16F-YFP purified and plunged using MISO (microfluidic isolation)
Authors:De Gieter, S., Eluru, G., Schenck, S., Stroobants, A., Efremov, R.G., Brunner, J.D.
Deposition date:2024-12-16
PDBID:9hqn
Status:HPUB -- hold until publication
Title:Cryo-EM structure of bovine TMEM206
Authors:Brunner, J.D., Schenck, S., De Gieter, S.
Deposition date:2024-12-16

238268

數據於2025-07-02公開中

PDB statisticsPDBj update infoContact PDBjnumon