| PDBID: | 8xjc | | Status: | HPUB -- hold until publication | | Title: | a novel haemophore of of Riemerella anatipestifer | | Authors: | Zhang, D.D., Chen, T.T. | | Deposition date: | 2023-12-21 |
|
| PDBID: | 8xiv | | Status: | HPUB -- hold until publication | | Title: | Production of D-psicose | | Authors: | Guo, D. | | Deposition date: | 2023-12-20 |
|
| PDBID: | 8xix | | Status: | HPUB -- hold until publication | | Title: | KeDt3e within Co | | Authors: | Guo, D. | | Deposition date: | 2023-12-20 |
|
| PDBID: | 8xj1 | | Status: | HPUB -- hold until publication | | Title: | Apo-KeDt3e | | Authors: | Guo, D.Y. | | Deposition date: | 2023-12-20 |
|
| PDBID: | 8ris | | Status: | HPUB -- hold until publication | | Title: | Computationally redesigend variant of Pyrrolysyl-tRNA Synthetase (Y306A) | | Authors: | Oberdorfer, G., Moser, M., Stoll, D. | | Deposition date: | 2023-12-19 |
|
| PDBID: | 8rip | | Status: | HPUB -- hold until publication | | Title: | Beta-keto acid cleavage enzyme from Paracoccus denitrificans with bound malonate and Coenzyme A | | Authors: | Marchal, D.G., Zarzycki, J., Erb, T.J. | | Deposition date: | 2023-12-19 |
|
| PDBID: | 8xic | | Status: | HOLD -- hold until a certain date | | Title: | Structure of Trioxacarcin A covalently bound to guanosine-2''-fluorinated d(AACCGGTT)2 | | Authors: | Gao, R.Q., Cao, C., Tang, G.L. | | Deposition date: | 2023-12-19 | | Release date: | 2024-12-19 |
|
| PDBID: | 8xgx | | Status: | HPUB -- hold until publication | | Title: | beta-1,4-galacosyltransferase | | Authors: | Luo, G., Huang, Z., Chen, J., Hou, X., Zhu, Y., Ni, D., Xu, W., Zhang, W., Rao, Y., Mu, W. | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8rgm | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of nucleosome containing Widom603 DNA | | Authors: | Motorin, N.A., Afonin, D., Armeev, G.A., Moiseenko, A., Zhao, L., Vasiliev, V., Oleinikov, P., Shaytan, A., Shi, X., Studitsky, V., Sokolova, O. | | Deposition date: | 2023-12-14 |
|
| PDBID: | 8vco | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of rMcL-1 in complex with N-acetyl-D-galactosamine | | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | | Deposition date: | 2023-12-14 | | Sequence: | >Entity 1
GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
| PDBID: | 8xg3 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of monomeric WDR11-FAM91A1 complex | | Authors: | Jia, G.W., Deng, Q.H., Su, Z.M., Jia, D. | | Deposition date: | 2023-12-14 |
|
| PDBID: | 8xeh | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HEPN-MNT complex | | Authors: | Jin, C., Jeon, C., Kim, D.H., Lee, B.J. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8xem | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of apo HEPN toxin | | Authors: | Jin, C., Jeon, C., Kim, D.H., Lee, B.J. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8xeo | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MNT antitoxin | | Authors: | Jin, C., Jeon, C., Kim, D.H., Lee, B.J. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8reg | | Status: | HPUB -- hold until publication | | Title: | Lysozyme measured via serial crystallography from a kapton HARE-chip (50 micron) | | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8reh | | Status: | HPUB -- hold until publication | | Title: | Lysozyme measured via serial crystallography from a kapton HARE-chip (125 micron) | | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8rei | | Status: | HPUB -- hold until publication | | Title: | CTX-M-14 measured via serial crystallography from a silicon HARE-chip. | | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8rem | | Status: | HPUB -- hold until publication | | Title: | CTX-M-14 measured via serial crystallography from a kapton HARE-chip (50 micron) | | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8vb3 | | Status: | HPUB -- hold until publication | | Title: | Dienelactone hydrolase from Solimonas fluminis | | Authors: | Schnettler Fernandez, J.D.F., Campbell, E.C., Hollfelder, F. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8xe8 | | Status: | HPUB -- hold until publication | | Title: | Solution structure of ubiquitin-like domain (UBL) of human ZFAND1 | | Authors: | Lai, C.H., Ko, K.T., Fan, P.J., Yu, T.A., Chang, C.F., Hsu, S.T.D. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8xdj | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AMPylated HEPN toxin | | Authors: | Jin, C., Jeon, C., Kim, D.H., Lee, B.J. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8xc7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of LL-D49194-alpha-1 covalently bound to guanosine-2''-fluorinated d(AACCGGTT)2 | | Authors: | Gao, R.Q., Tang, G.L., Cao, C. | | Deposition date: | 2023-12-08 | | Release date: | 2024-12-08 |
|
| PDBID: | 8xc8 | | Status: | HPUB -- hold until publication | | Title: | beta-1,4-galacosyltransferase | | Authors: | Luo, G., Huang, Z., Chen, J., Hou, X., Zhu, Y., Ni, D., Xu, W., Zhang, W., Rao, Y., Mu, W. | | Deposition date: | 2023-12-08 |
|
| PDBID: | 8rcz | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the enoyl-ACP reductase FabV from Pseudomonas aeruginosa with NADH cofactor | | Authors: | Vandebroek, L., Van Olmen, F., Voet, A.R.D., Verwilst, P. | | Deposition date: | 2023-12-07 |
|
| PDBID: | 8rcx | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Crystal structure of the Mycobacterium tuberculosis regulator VirS (N-terminal fragment 4-208) in complex with the drug candidate alpibectir | | Authors: | Edoo, Z., Frita, R., Grosse, C., Bourotte, M., Moune, M., Antoine, R., Trebosc, V., Schellhorn, B., Dreneau, A., Hofmann, L., Kemmer, C., Lociuro, S., Dale, G.E., Jung, F., Perez-Herran, E., Mendoza, A., Rebollo Lopez, M.J., Ghidelli-Disse, S., Drewes, G., Mathys, V., Soetaert, K., Megalizzi, V., Wintjens, R., Barros Aguirre, D., Remuinan, M.D., Gitzinger, M., Deprez, B., Willand, N., Pieren, M., Baulard, A.R. | | Deposition date: | 2023-12-07 |
|
