| PDBID: | 9hqf | | Status: | HPUB -- hold until publication | | Title: | SARM1 TIR domain in complex with compound 7-ADPR | | Authors: | Giroud, M., Kuhn, B., Steiner, S., Westwood, P., Mendel, M., Mani, A., Pinard, E., Haap, W., Grether, U., Caramenti, P., Rombach, D., Zambaldo, C., Ritter, M., Schmid, P., Gasser, C., Aregger, N., Sechet, N., Topp, A., Bilyard, M., Malnight-Alvarez, A., Plitzko, I., Hilbert, M., Kalayil, S., Burger, D., Bonardi, C., Saal, W., Haider, A., Wittwer, M., Brigo, A., Keaney, J., Benz, J. | | Deposition date: | 2024-12-16 | | Sequence: | >Entity 1
GGSSGSGDTPDVFISYRRNSGSQLASLLKVHLQLHGFSVFIDVEKLEAGKFEDKLIQSVMGARNFVLVLSPGALDKCMQDHDCKDWVHKEIVTALSCGKNIVPIIDGFEWPEPQVLPEDMQAVLTFNGIKWSHEYQEATIEKIIRFLQ
|
|
| PDBID: | 9hpl | | Status: | HPUB -- hold until publication | | Title: | E. coli beta-galactosidase labeled with Chromeo P503 dye purified using MISO | | Authors: | Eluru, G., De Gieter, S., Stroobants, A., Efremov, R.G. | | Deposition date: | 2024-12-13 |
|
| PDBID: | 9hpm | | Status: | HPUB -- hold until publication | | Title: | E. coli beta-galactosidase labeled with Chromeo P503 dye purified using MISO from 1ug | | Authors: | Eluru, G., De Gieter, S., Stroobants, A., Efremov, R.G. | | Deposition date: | 2024-12-13 |
|
| PDBID: | 9hpo | | Status: | HPUB -- hold until publication | | Title: | Docedameric RuvBL1/RuvBL2 | | Authors: | Santo, P.E., Plisson-Chastang, C. | | Deposition date: | 2024-12-13 |
|
| PDBID: | 9hnj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | NMR solution structure of OrfM from ICESt3 of Streptococcus thermophilus | | Authors: | Tsan, P., Cappele, J., Laroussi, H., Clement, E., Favier, F., Didierjean, C., Soler, N., Leblond-Bourget, N. | | Deposition date: | 2024-12-10 |
|
| PDBID: | 9kyc | | Status: | HPUB -- hold until publication | | Title: | PltBd1/PltBd2 heteropentameric holotoxin from E. coli | | Authors: | Chen, Z., Wang, D.D., Gao, X. | | Deposition date: | 2024-12-08 |
|
| PDBID: | 9kye | | Status: | HPUB -- hold until publication | | Title: | PltBd2 homopentameric holotoxin from E. coli | | Authors: | Chen, Z., Wang, D.D., Gao, X. | | Deposition date: | 2024-12-08 |
|
| PDBID: | 9ky9 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of E. coli tryptophanyl-tRNA synthetase complexed with 3-methylchuangxinmycin and tryptophanyl-5''-AMP | | Authors: | Ren, Y., Wang, S., Liu, W., Fang, P. | | Deposition date: | 2024-12-08 |
|
| PDBID: | 9kyd | | Status: | HPUB -- hold until publication | | Title: | PltBd1 homopentameric holotoxin from E. coli | | Authors: | Chen, Z., Wang, D.D., Gao, X. | | Deposition date: | 2024-12-08 |
|
| PDBID: | 9kxr | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of E. coli tryptophanyl-tRNA synthetase complexed with chuangxinmycin and tryptophanyl-5''-AMP | | Authors: | Ren, Y., Wang, S., Liu, W., Fang, P. | | Deposition date: | 2024-12-07 |
|
| PDBID: | 9ky3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of E. coli tryptophanyl-tRNA synthetase complexed with 3-demethylchuangxinmycin and tryptophanyl-5''-AMP | | Authors: | Ren, Y., Wang, S., Liu, W., Fang, P. | | Deposition date: | 2024-12-07 |
|
| PDBID: | 9hm1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of GSK3b in complex with N-(4-{5-[(2-aminoethyl)sulfamoyl]thiophen-2-yl}pyridin-2-yl)cyclopropanecarboxamide inhibitor | | Authors: | Slugocka, E.A., Grygier, P., Wichur, T., Czarna, A., Wieckowska, A. | | Deposition date: | 2024-12-06 |
|
| PDBID: | 9me3 | | Status: | HPUB -- hold until publication | | Title: | Bruton''s tyrosine kinase with mutations in the activation loop in complex with compound P301390 | | Authors: | Lin, D.Y., Andreotti, A.H., Tonge, P.J., Bravo, E., Li, X. | | Deposition date: | 2024-12-06 |
|
| PDBID: | 9kwd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of E.coli LysU complexing with LysSA and ATP | | Authors: | Xia, M., Hei, Z., Fang, P. | | Deposition date: | 2024-12-05 |
|
| PDBID: | 9md8 | | Status: | HPUB -- hold until publication | | Title: | Hip1 complex with inhibitor #2 (Hip1-2) via Ser228 | | Authors: | Yim, M.K., Schumann, N.C., Goldfarb, N.E., Johnson, S.J. | | Deposition date: | 2024-12-05 |
|
| PDBID: | 9md7 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Hip1 complex with inhibitor #1 (Hip1-1) via Ser228 | | Authors: | Yim, M.K., Olsen, K.J., Brooks, C.L., Pena, K.J., Johnson, S.J., Goldfarb, N.E. | | Deposition date: | 2024-12-05 |
|
| PDBID: | 9hkr | | Status: | HPUB -- hold until publication | | Title: | NMR structure of the C-terminal domain of the human SPAG1 protein | | Authors: | Chagot, M.E., Quinternet, M. | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9hl9 | | Status: | HPUB -- hold until publication | | Title: | CRYO-EM STRUCTURE OF LEISHMANIA MAJOR 80S RIBOSOME WITH P/E-site tRNA AND mRNA : LM14Cs1H3 sKO STRAIN | | Authors: | Rajan, K.S., Yonath, A. | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9hku | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of CREBBP histone acetyltransferase domain in complex with Acetyl-Coenzyme A | | Authors: | Mechaly, A.E., Zhang, W., Cui, G., Green, M.R., Rodrigues-Lima, F. | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9kun | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ligand-free trypanosome alternative oxidase | | Authors: | Ebiloma, G.U., Balogun, E.O., Dardonville, C., Shiba, T., De Koning, H.P. | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9kty | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the TIA-1 prion-like domain amyloid fibril, WT | | Authors: | Inaoka, D., Miyata, T., Makino, F., Ohtani, Y., Ekari, M., Kobayashi, R., Imamura, K., Sakamoto, E., Kodama, S.T., Yoshida, N., Kato, T., Namba, K., Tochio, H., Sekiyama, N. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ktz | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the TIA-1 prion-like domain amyloid fibril, G355R | | Authors: | Inaoka, D., Miyata, T., Makino, F., Ohtani, Y., Ekari, M., Kobayashi, R., Imamura, K., Sakamoto, E., Kodama, S.T., Yoshida, N., Kato, T., Namba, K., Tochio, H., Sekiyama, N. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ku8 | | Status: | HPUB -- hold until publication | | Title: | Solution NMR structure of P1 peptide bound with E. coli LPS | | Authors: | Mohid, S.A., Bhunia, A. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ek9 | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of the mutant (R140Q) IDH2 homodimer | | Authors: | Forouhar, F., Hou, S., Wang, J., Wang, C., Limbad, C., Park, J., Zohrabian, S., Moskowitz, A., Correa, F., Takemoto, N., Waterman, A., Thompson, V., Kramer, K., Liu, E.M., de Stanchina, E., Xiao, W., Garippa, R., Reznik, E., Intlekofer, A.M. | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9eki | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the Michaelis complex of the mutant (R140Q) IDH2 homodimer | | Authors: | Forouhar, F., Hou, S., Wang, J., Wang, C., Limbad, C., Park, J., Zohrabian, S., Moskowitz, A., Correa, F., Takemoto, N., Waterman, A., Thompson, V., Kramer, K., Liu, E.M., de Stanchina, E., Xiao, W., Garippa, R., Reznik, E., Intlekofer, A.M. | | Deposition date: | 2024-12-02 |
|
