| PDBID: | 9iin | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of CTF18-PCNA with ATP and Mg2+ | | Authors: | Briola, G.R., Tehseen, M., Al-Amodi, A., Nguyen, P.Q., Savva, C.G., Hamdan, S.M., De Biasio, A. | | Deposition date: | 2024-06-20 |
|
| PDBID: | 9fru | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human Sirt2 in complex with a pyrazole-based fragment inhibitor and NAD+ | | Authors: | Friedrich, F., Einsle, O., Jung, M. | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9frp | | Status: | HPUB -- hold until publication | | Title: | Human PARP10 ART domain bound to a phthalazinone-based inhibitor. | | Authors: | Moche, M., Upadhayaya, K., Cohen, M.S., Schuler, H. | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9frs | | Status: | HPUB -- hold until publication | | Title: | Human PARP10 ART domain bound to a phthalazinone-based inhibitor | | Authors: | Moche, M., Upadhyaya, K., Cohen, M.S., Schuler, H. | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9fr6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human GSK3B in complex with ARN25641 | | Authors: | Dalle Vedove, A., Demuro, S., Di Martino, R.M.C., Balboni, B., Tripathi, S.K., Storici, P., Girotto, S., Cavalli, A. | | Deposition date: | 2024-06-18 |
|
| PDBID: | 9frd | | Status: | HPUB -- hold until publication | | Title: | Wildtype EGFR bound with Compound 23 | | Authors: | Pagliarini, A.R., Milgram, B.C., Borrelli, D.R., OHearn, E., Huff, M.R., Ladd, B., Brooijmans, N., Henderson, J.A., Hilbert, B.J., Wang, W., Ito, T. | | Deposition date: | 2024-06-18 |
|
| PDBID: | 9cb6 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of RT-PhyR (ruthe_02744) | | Authors: | Swingle, D., Isiorho, E.A., Gardner, K.H. | | Deposition date: | 2024-06-18 | | Sequence: | >Entity 1
GEFMPQTFADAVAASLPHLRRYARALTGEQRTGDAIAARTLEGLIADPSVLERDLEPRLMLFRAFHRTWRREGAPVGEADSHLAQRAQSHLARLTPNTREALLLHAIEGFTAQEIGAVMEVPPETAADFIDTALREMAESVAGRVMIIEDEAIIAMDIAAIVREMGHRVTGIARTRFEAVRLAREERPDLILADIQLADNSSGIDAVNEILAEFADLPVIFITAFPERLLTGERPEPAFLITKPYREEQVRSAVSQAMFFASTETLAA
|
|
| PDBID: | 9fqf | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Studies on chimeric PeAFB | | Authors: | Gallego del Sol, F., Marina, A. | | Deposition date: | 2024-06-17 |
|
| PDBID: | 9fqg | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Studies on chimeric PeAFB | | Authors: | Gallego del Sol, F., Marina, A. | | Deposition date: | 2024-06-17 |
|
| PDBID: | 9fqk | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Perkinsus marinus Respiratory complex II soluble region | | Authors: | Wu, F., Amunts, A. | | Deposition date: | 2024-06-17 |
|
| PDBID: | 9fqz | | Status: | HPUB -- hold until publication | | Title: | CRYO-EM STRUCTURE OF HCT15 POLYSOMES BOUND TO EEF2, EBP1, AND SERBP1 | | Authors: | Rajan, K.S., Yonath, A. | | Deposition date: | 2024-06-17 |
|
| PDBID: | 9fql | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of hDM2 in complex with a peptidic ligand containing a di-urea insert. | | Authors: | Buratto, J., Mauran, L., Goudreau, S., Guichard, G. | | Deposition date: | 2024-06-17 |
|
| PDBID: | 9fqt | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of MmCAT1 bound with FrMLV-RBD in the apo inward-open state | | Authors: | Ye, M., Zhou, D., Pike, A.C.W., Wang, S., Wang, D., Bakshi, S., Brooke, L., Williams, E., Elkins, J., Stuart, D.I., Sauer, D.B. | | Deposition date: | 2024-06-17 |
|
| PDBID: | 9fqu | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of MmCAT1 bound with FrMLV-RBD in the arginine-bound inward-occluded state | | Authors: | Ye, M., Zhou, D., Pike, A.C.W., Wang, S., Wang, D., Bakshi, S., Brooke, L., Williams, E., Elkins, J., Stuart, D.I., Sauer, D.B. | | Deposition date: | 2024-06-17 |
|
| PDBID: | 9fqv | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of MmCAT1 bound with FrMLV-RBD in the lysine-bound inward-occluded state | | Authors: | Ye, M., Zhou, D., Pike, A.C.W., Wang, S., Wang, D., Bakshi, S., Brooke, L., Williams, E., Elkins, J., Stuart, D.I., Sauer, D.B. | | Deposition date: | 2024-06-17 |
|
| PDBID: | 9fqw | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of MmCAT1 bound with FrMLV-RBD in the ornithine-bound inward-occluded state | | Authors: | Ye, M., Zhou, D., Pike, A.C.W., Wang, S., Wang, D., Bakshi, S., Brooke, L., Williams, E., Elkins, J., Stuart, D.I., Sauer, D.B. | | Deposition date: | 2024-06-17 |
|
| PDBID: | 9cap | | Status: | HPUB -- hold until publication | | Title: | Structure of LPD-3 in complex with Spigot and Intake | | Authors: | Clark, S.A., Kang, Y. | | Deposition date: | 2024-06-17 |
|
| PDBID: | 8zy1 | | Status: | HPUB -- hold until publication | | Title: | A locked conformation of spike protein trimer of Sarbecovirus | | Authors: | Wang, J., Xiong, X. | | Deposition date: | 2024-06-16 |
|
| PDBID: | 9c9w | | Status: | HPUB -- hold until publication | | Title: | Dimerized human TOP3B-TDRD3 core complex with a DNA mismatch bubble | | Authors: | Yang, X. | | Deposition date: | 2024-06-16 |
|
| PDBID: | 9fpx | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of DYRK1A in complex with Curcumin | | Authors: | Grygier, P., Pustelny, K., Czarna, A. | | Deposition date: | 2024-06-14 |
|
| PDBID: | 9fq1 | | Status: | HPUB -- hold until publication | | Title: | Structure of the disease-causing mutant P20S of human KCTD1 | | Authors: | Balasco, N., Ruggiero, A., Smaldone, G., Esposito, L., Berisio, R., Vitagliano, L. | | Deposition date: | 2024-06-14 | | Sequence: | >Entity 1
MSRPLITRSPASPLNNQGISTPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPESRIGRLFDGTEPIVLDSLKQHYFIDRDGQMFRYILNFLRTSKLLIPDDFKDYTLLYEEAKYFQLQPMLLEMERWKQDRETGRFSRPCECLVVRVAPDLGERITLSGDKSLIEEVFPEIGDVMCNSVNAGWNHDSTHVIRFPLNGYCHLNSVQVLERLQQRGFEIVGSCGGGVDSSQFSEYVLRRELRRTPRVPSVIRIKQEPLD
|
|
| PDBID: | 9fq4 | | Status: | HPUB -- hold until publication | | Title: | Glyceraldehyde 3-phosphate dehydrogenase A (GAPDHA) NADP holoenzyme, from Helicobacter pylori, with active site cysteine oxidised to sulfenic acid | | Authors: | Foster, S.P., Moody, P.C.E. | | Deposition date: | 2024-06-14 |
|
| PDBID: | 9fq7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Perkinsus marinus Respiratory supercomplex CII2CIII2CIV2 in c1 sate | | Authors: | Wu, F., Amunts, A. | | Deposition date: | 2024-06-14 |
|
| PDBID: | 9fq8 | | Status: | HPUB -- hold until publication | | Title: | Perkinsus marinus Respiratory complex CIV | | Authors: | Wu, F., Amunts, A. | | Deposition date: | 2024-06-14 |
|
| PDBID: | 8zxl | | Status: | HOLD -- hold until a certain date | | Title: | Structure of a hierarchical intermediate region (spindlefirbil) of human collagen type | | Authors: | Zhang, L.J., Fang, B.H. | | Deposition date: | 2024-06-14 | | Release date: | 2025-06-14 | | Sequence: | >Entity 1
GAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQGAPGAPGSQGAPGLQ
|
|
