| PDBID: | 9qqf | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the WIM8E5 Fab - HLA-A*11:01 human alloantibody-HLA complex | | Authors: | Zampieri, V., Priddey, A., Humm, A.S., Pellegrini, E., Heidt, S., Kosmoliaptsis, V., Marquez, J.A. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9u74 | | Status: | HOLD -- hold until a certain date | | Title: | Respiratory Syncytial Virus pre-F trimer bound by neutralizing antibody PR306007 | | Authors: | Zheng, Z., Zixian, S., Rui, F., Yu, G. | | Deposition date: | 2025-03-24 | | Release date: | 2026-03-24 |
|
| PDBID: | 9nw4 | | Status: | HPUB -- hold until publication | | Title: | Structure of CISV1 antibody bound to PvCSP repeat peptide | | Authors: | Hurlburt, N.K., Pancera, M. | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9nvw | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of rhesus antibody CH35-Apex1.08 in complex with HIV Env trimer Q23-APEX-GT2 | | Authors: | Roark, R.S., Shapiro, L.S., Kwong, P.D. | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9nw0 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of rhesus antibody CH42-Apex1.01 in complex with HIV Env trimer Q23-APEX-GT2 | | Authors: | Roark, R.S., Shapiro, L.S., Kwong, P.D. | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9nw1 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of rhesus antibody CH42-Apex2.01 in complex with HIV Env trimer Q23-APEX-GT2 | | Authors: | Roark, R.S., Shapiro, L.S., Kwong, P.D. | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9nvz | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of rhesus antibody CH70-Apex1.01 in complex with HIV Env trimer Q23-APEX-GT2 | | Authors: | Roark, R.S., Shapiro, L.S., Kwong, P.D. | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9u3j | | Status: | HPUB -- hold until publication | | Title: | Helical structure of DENV2-THSTI/TRC/01 bound with D14.F05.S03 antibody Fab fragment | | Authors: | Chaterjee, A., Roy, A., Srinivasa, S., Charles, S., Lubow, J., Goo, L., Prasad, V.M. | | Deposition date: | 2025-03-18 |
|
| PDBID: | 9nry | | Status: | HPUB -- hold until publication | | Title: | Venezuelan Equine Encephalitis Virus in complex with the single domain antibody V2C3 | | Authors: | Pletnev, S., Kwong, P.D., Zhou, T. | | Deposition date: | 2025-03-14 |
|
| PDBID: | 9nrz | | Status: | HPUB -- hold until publication | | Title: | Venezuelan Equine Encephalitis Virus in complex with the single domain antibody V3A8f | | Authors: | Pletnev, S., Kwong, P.D., Zhou, T. | | Deposition date: | 2025-03-14 |
|
| PDBID: | 9nrx | | Status: | HPUB -- hold until publication | | Title: | Venezuelan Equine Encephalitis Virus in complex with the single domain antibody V2B3 | | Authors: | Pletnev, S., Kwong, P.D., Zhou, T. | | Deposition date: | 2025-03-14 |
|
| PDBID: | 9ma7 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of EBV gp350 D123 in complex with neutralizing antibody 1A12 and 1H5 and non-neutralizing antibody 2E9 | | Authors: | Ma, H.Y., Sun, C. | | Deposition date: | 2025-03-14 |
|
| PDBID: | 9ma0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of EBV gp350 D123 in complex with neutralizing antibody 4A11 | | Authors: | Ma, H.Y., Sun, C. | | Deposition date: | 2025-03-13 |
|
| PDBID: | 9m6j | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of S. aureus protein A bound to a camelid single-domain antibody | | Authors: | Kong, Y., Shi, J.L., Wu, F.D., Zhao, T., Zhu, X.Y., Xu, Q.Y., Wang, R.B., Song, Y.D., Li, Q.X., Wang, Y.L., Gao, X.Y., Yang, Y.D., Wu, Y.L., Yang, Z.L., Yao, J.H., Ying, T.L. | | Deposition date: | 2025-03-07 |
|
| PDBID: | 9m6o | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of S. aureus protein A bound to a camelid single-domain antibody | | Authors: | Kong, Y., Shi, J.L., Wu, F.D., Zhao, T., Zhu, X.Y., Xu, Q.Y., Wang, R.B., Song, Y.D., Li, Q.X., Wang, Y.L., Gao, X.Y., Yang, Y.D., Wu, Y.L., Yang, Z.L., Yao, J.H., Ying, T.L. | | Deposition date: | 2025-03-07 |
|
| PDBID: | 9m5d | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of S. aureus protein A bound to a human single-domain antibody | | Authors: | Kong, Y., Shi, J.L., Ying, T.L., Yang, Z.L., Xu, Q.Y. | | Deposition date: | 2025-03-05 |
|
| PDBID: | 9nj9 | | Status: | HPUB -- hold until publication | | Title: | Computationally optimized broadly reactive influenza B hemagglutinin BC2 bound by antibodies #46 and #3978 | | Authors: | Dzimianski, J.V., Kunkel, I., Balasco Serrao, V.H., DuBois, R.M. | | Deposition date: | 2025-02-27 |
|
| PDBID: | 9nja | | Status: | HPUB -- hold until publication | | Title: | Computationally optimized broadly reactive influenza B hemagglutinin BC2 bound by antibody #46 | | Authors: | Dzimianski, J.V., Kunkel, I., Balasco Serrao, V.H., DuBois, R.M. | | Deposition date: | 2025-02-27 |
|
| PDBID: | 9nj3 | | Status: | HPUB -- hold until publication | | Title: | Computationally optimized broadly reactive influenza B hemagglutinin BC2 bound by antibodies #46 and #3978 | | Authors: | Dzimianski, J.V., Kunkel, I., Balasco Serrao, V.H., DuBois, R.M. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9nj6 | | Status: | HPUB -- hold until publication | | Title: | Computationally optimized broadly reactive influenza B hemagglutinin BC2 bound by antibody #3978 | | Authors: | Dzimianski, J.V., Kunkel, I., Balasco Serrao, V.H., DuBois, R.M. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9ly5 | | Status: | HPUB -- hold until publication | | Title: | antibody 20G5 Fab in complex with human B7-H3 (IgC) | | Authors: | Bin, L., Shuaixiang, Z., kaijie, H. | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9ly6 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | antibody 20G5 (Fab'')2 in complex with human B7-H3 | | Authors: | Li, B., Zhou, S., He, K. | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9ib1 | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM focus map of prefusion SARS-CoV-2 spike (RBDs: 1 up & 2 down) bound to RBD-targeting MO176-117 antibody | | Authors: | Schulte, T., Wallden, W., Andrell, J., Ohlin, M. | | Deposition date: | 2025-02-11 | | Release date: | 2026-02-11 |
|
| PDBID: | 9n7k | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human anti-Pfs48/45 transmission-blocking antibody RUPA-71 | | Authors: | Hailemariam, S., Ivanochko, D., Julien, J.P. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9n7w | | Status: | HPUB -- hold until publication | | Title: | antibody 5E10 Fab | | Authors: | Rupert, P.B., Strong, R.K. | | Deposition date: | 2025-02-06 | | Sequence: | >Entity 1
DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTFKLLIYYTSRLHSGVPSRFSGGGSGTDYSLTISNLEKEDIATYFCQQGNTLPRTFGGGTRLEVKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
>Entity 2
(PCA)VQLLQPGAELVRPGASVRLSCKTSGYTFTSYWINWVKQRPGQGLEWIGKIFPSDSHTNYNQKFKDKATLTVDKSSSTAYMQLISPTSEDSAVYYCTRDFDTQFYAMEYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
|
|
