| PDBID: | 9lvb | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-02-12 | | Release date: | 2026-02-12 |
|
| PDBID: | 9lvu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of de novo design trimer protein | | Authors: | Zhao, L. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9lvf | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-12 | | Release date: | 2026-02-12 |
|
| PDBID: | 9lvk | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9lvi | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-12 | | Release date: | 2026-02-12 |
|
| PDBID: | 9lvm | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of IscS-PptA complex | | Authors: | Fei, Y.W. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9lvs | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the SARS-CoV-2 spike protein in complex with S416 | | Authors: | Fang, Y., Binghao, Z. | | Deposition date: | 2025-02-12 | | Release date: | 2026-02-12 |
|
| PDBID: | 9lvq | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9lvn | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of phospholipase D SkPLD (Streptomyces klenkii) | | Authors: | Hu, R.K., Feng, C.H. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9lvp | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9lvw | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9n9t | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Main protease of PEDV in complex with AVI8122 | | Authors: | Chen, P., Lu, J., Lemieux, M.J. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9n9u | | Status: | HPUB -- hold until publication | | Title: | Camel alphacoronavirus (229E-like) Nsp5 in complex with AVI8122 | | Authors: | Chen, P., Lu, J., Lemieux, M.J. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9n9v | | Status: | HPUB -- hold until publication | | Title: | Main protease of MERS in complex with AVI8122 | | Authors: | Chen, P., Lu, J., Lemieux, M.J. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9na0 | | Status: | HPUB -- hold until publication | | Title: | Main protease of HKU8 in complex with AVI8122 | | Authors: | Chen, P., Lu, J., Lemieux, M.J. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9n9m | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9n9q | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9n9o | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9n9w | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of AMPPNP bound human phosphoribosylformylglycinamidine synthase | | Authors: | Sharma, N., French, J.B. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9n9n | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of KRAS(G12C) bound to the cyclic peptide UNC10415730A | | Authors: | Rossman, K.L. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9n9p | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9n9k | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9nab | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the alpha5beta1 integrin headpiece with OS2966 Fab | | Authors: | Wang, L., Zhang, C. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9na1 | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9nad | | Status: | HPUB -- hold until publication | | Title: | Human GSTO1-1 complexed with C5-1 | | Authors: | Oakley, A.J. | | Deposition date: | 2025-02-11 | | Sequence: | >Entity 1
SGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
|
|
