PDBID: | 9ohd | Status: | HPUB -- hold until publication | Title: | CryoEM structure of Toxin B (TcdB) from clostridioides difficile complexed with methyl cholate | Authors: | Miletic, S., Li, Z., Melnyk, R.A. | Deposition date: | 2025-05-04 |
|
PDBID: | 9ohe | Status: | HPUB -- hold until publication | Title: | CryoEM structure of apo Toxin B (TcdB) from Clostridioides difficile in the closed CROP state | Authors: | Miletic, S., Li, Z., Melnyk, R.A. | Deposition date: | 2025-05-04 |
|
PDBID: | 9ohf | Status: | HPUB -- hold until publication | Title: | CryoEM structure of apo Toxin B (TcdB) from Clostridioides difficile in the open CROP state | Authors: | Miletic, S., Li, Z., Melnyk, R.A. | Deposition date: | 2025-05-04 |
|
PDBID: | 9ohb | Status: | HPUB -- hold until publication | Title: | Structure of of Undecaprenyl diphosphate synthase (UPPS) from Neisseiria gonorrohea soaked with the fragment PS-5485 | Authors: | Santiago, A.S., Llontop, E.E., Amaral, B.S., Ramos, P.Z., Piccirillo, E., Almeida, V.M., Massirer, K.B., Counago, R.M. | Deposition date: | 2025-05-04 |
|
PDBID: | 9oh8 | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | Apo structure of Undecaprenyl diphosphate synthase (UPPS) from Neisseiria gonorrohea | Authors: | Santiago, A.S., Llontop, E.E., Ramos, P.Z., Piccirillo, E., Almeida, V.M., Barreiro, G., Massirer, K.B., Counago, R.M. | Deposition date: | 2025-05-03 | Release date: | 2026-05-03 |
|
PDBID: | 9oha | Status: | HPUB -- hold until publication | Title: | Structure of of Undecaprenyl diphosphate synthase (UPPS) from Neisseiria gonorrohea co-crystallized with BPH-1100 | Authors: | Santiago, A.S., Llontop, E.E., Amaral, B.S., Ramos, P.Z., Piccirillo, E., Almeida, V.M., Massirer, K.B., Counago, R.M. | Deposition date: | 2025-05-03 |
|
PDBID: | 9r32 | Status: | HPUB -- hold until publication | Title: | CRYSTAL STRUCTURE OF LYSYL-TRNA SYNTHETASE FROM Cryptosporidium parvum COMPLEXED WITH L-LYSINE AND INHIBITOR DDD01887015 | Authors: | Dawson, A., Baragana, B., Forte, B. | Deposition date: | 2025-05-02 |
|
PDBID: | 9us7 | Status: | AUCO -- author corrections pending review | Title: | Crystal Structure of Hemophore HphA from A. baumannii with Cobalt Phthalocyanine | Authors: | Nguyen, V.Q., Sugimoto, H., Shoji, O. | Deposition date: | 2025-05-01 |
|
PDBID: | 9ogt | Status: | HPUB -- hold until publication | Title: | HIV-1 Env BG505 SOSIP.664-His in complex with PGT122 and 3BNC117 Fabs | Authors: | Andrade, T.G., Ozorowski, G., Ward, A.B. | Deposition date: | 2025-05-01 |
|
PDBID: | 9ogu | Status: | AUTH -- processed, waiting for author review and approval | Title: | HIV-1 Env BG505 SOSIP.664-dPG-His in complex with PGT122 and 3BNC117 Fabs | Authors: | Andrade, T.G., Ozorowski, G., Ward, A.B. | Deposition date: | 2025-05-01 |
|
PDBID: | 9ogp | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Structure of Hepatitis C Virus Envelope Glycoprotein HCV-1 E2ecto from genotype 1a bound to neutralizing antibody K579 | Authors: | Nguyen, T.K.Y., Wilson, I.A. | Deposition date: | 2025-05-01 |
|
PDBID: | 9ogm | Status: | HPUB -- hold until publication | Title: | BG505 MD39.3 Env gp151 MPER nanodisc in complex with 10E8, BG18 and VRC01 Fabs (1x 10E8 Fab) | Authors: | Rantalainen, K., Ozorowski, G., Gharpure, A., Ward, A.B. | Deposition date: | 2025-05-01 |
|
PDBID: | 9urz | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of the Prohibitin complex from Chaetomium thermophilum | Authors: | Luo, D.Y., Zheng, L.Q., Lu, M.A., Chen, Z.Y., Wang, P.P., Guo, Q., Gao, N. | Deposition date: | 2025-04-30 |
|
PDBID: | 9ogl | Status: | HPUB -- hold until publication | Title: | BG505 MD39.3 SOSIP.664 in complex with 3BC315, BG18 and VRC01 Fabs | Authors: | Ozorowski, G., Phulera, S., Ward, A.B. | Deposition date: | 2025-04-30 |
|
PDBID: | 9r2s | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Structure of the S.aureus ClpP degradation chamber in the context of the MecA/ClpC/CLpC complex | Authors: | Azinas, S., Wallden, K., Katikaridis, P., Schahl, A., Mogk, A., Carroni, M. | Deposition date: | 2025-04-30 |
|
PDBID: | 9urf | Status: | HPUB -- hold until publication | Title: | Crystal structure of beta-glucosidase from Bacteroides ovatus | Authors: | Kumar, A.K., Jamdar, S.N., Sarver, R., Makde, R.D. | Deposition date: | 2025-04-29 |
|
PDBID: | 9urg | Status: | HPUB -- hold until publication | Title: | Crystal structure of beta-glucosidase from Bacteroides ovatus bound to beta-D-Glucose | Authors: | Kumar, A.K., Jamdar, S.N., Sarver, R., Makde, R.D. | Deposition date: | 2025-04-29 |
|
PDBID: | 9urd | Status: | HPUB -- hold until publication | Title: | Crystal structure of Zinc-binding metallopeptidase (Uniprot: A0AAN3A8D2) from Bacteroides ovatus | Authors: | Kulkarni, B.S., Kumar, A.K., Jamdar, S.N., Makde, R.D. | Deposition date: | 2025-04-29 |
|
PDBID: | 9of4 | Status: | HPUB -- hold until publication | Title: | Structure of the Acinetobacter baumannii Response Regulator PmrA Receiver Domain M12I Mutation | Authors: | Jaimes, F.E., Milton, M.E., Hondros, A.D., Cavanagh, J. | Deposition date: | 2025-04-29 |
|
PDBID: | 9oex | Status: | HPUB -- hold until publication | Title: | K-Ras G12V at 293 K | Authors: | Xu, M., Deck, S.L., Milano, S.K., Cerione, R.A. | Deposition date: | 2025-04-29 |
|
PDBID: | 9ofa | Status: | HPUB -- hold until publication | Title: | The structure of a Fungal Cyanide Hydratase from Gloeocercospora sorghi | Authors: | Justo Arevalo, S., Valle-Riestra F, V., Balan, A., Farah, C.S. | Deposition date: | 2025-04-29 | Sequence: | >Entity 1 MPINKYKAAVVTSEPVWENLEGGVVKTIEFINEAGKAGCKLIAFPEVWIPGYPYWMWKVNYLQSLPMLKAYRENSIAMDSSEMRRIRAAARDNQIYVSIGVSEIDHATLYLTQVLISPLGDVINHRRKIKPTHVEKLVYGDGSGDSFEPVTQTEIGRLGQLNCWENMNPFLKSLAVARGEQIHVAAWPVYPDLSKQVHPDPATNYADPASDLVTPAYAIETGTWVLAPFQRISVEGLKRHTPPGVEPETDATPYNGHARIFRPDGSLYAKPAVDFDGLMYVDIDLNESHLTKALADFAGHYMRPDLIRLLVDTRRKELVTEVGGGDNGGIQSYSTMARLGLDRPLEEEDYRQGTDAGETEKASSNGHA
|
|
PDBID: | 9r21 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of the flotillin-associated rhodopsin PsFAR in detergent micelle | Authors: | Kovalev, K., Stetsenko, A., Marin, E., Guskov, A. | Deposition date: | 2025-04-29 |
|
PDBID: | 9r22 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of the light-driven proton pump PsPR in detergent micelle | Authors: | Kovalev, K., Stetsenko, A., Guskov, A. | Deposition date: | 2025-04-29 |
|
PDBID: | 9r23 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of the double mutant H84V/E120G of the flotillin-associated rhodopsin PsFAR in detergent micelle | Authors: | Kovalev, K., Stetsenko, A., Guskov, A. | Deposition date: | 2025-04-29 |
|
PDBID: | 9r2c | Status: | HPUB -- hold until publication | Title: | CpKRS in complex with inhibitor DDD01038762 | Authors: | Dawson, A., Baragana, B., Robinson, D.A. | Deposition date: | 2025-04-29 |
|