| PDBID: | 9w7q | | Status: | HPUB -- hold until publication | | Title: | SuperFi Cas9 - 20nt sgRNA - DNA ternary complex Class A | | Authors: | Zheng, R., Ma, L.J. | | Deposition date: | 2025-08-06 |
|
| PDBID: | 9w7p | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Ledaborbactam in complex with SME-1 class A Carbapenemase | | Authors: | Dhankhar, K., Hazra, S. | | Deposition date: | 2025-08-06 |
|
| PDBID: | 9pxa | | Status: | HPUB -- hold until publication | | Title: | BG505/CH505wk4 Env chimeric SOSIP in complex with CH103 and RM19R Fabs | | Authors: | Cottrell, C.A., Ozorowski, G., Wu, N.R., Ward, A.B. | | Deposition date: | 2025-08-05 |
|
| PDBID: | 9pxe | | Status: | HPUB -- hold until publication | | Title: | JRFL.TD15 membrane Env liposome in complex with CH103.H17L8 Fab | | Authors: | Karlinsey, D.C., Ozorowski, G., Ward, A.B. | | Deposition date: | 2025-08-05 |
|
| PDBID: | 9s8j | | Status: | HPUB -- hold until publication | | Title: | Structure of protein kinase CK2alpha mutant R191Q associated with the Okur-Chung Neurodevelopmental Syndrome | | Authors: | Werner, C., Gast, A., Meyer, S.C., Jose, J., Niefind, K. | | Deposition date: | 2025-08-05 |
|
| PDBID: | 9s7u | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of human glutamate carboxypeptidase II (GCPII) - the E424M inactive mutant, in complex with an inhibitor Ac-gamma-Glu-Dap(thiooxalyl)-OH | | Authors: | Novakova, Z., Schenkmayerova, A., Motlova, L., Barinka, C. | | Deposition date: | 2025-08-05 |
|
| PDBID: | 9s7z | | Status: | HPUB -- hold until publication | | Title: | Structure of truncated human 60 kDa lysophospholipase at 2.73 A resolution | | Authors: | Rabe von Pappenheim, F., Eulig, N., Mahler, M., Tittmann, K. | | Deposition date: | 2025-08-05 |
|
| PDBID: | 9s7y | | Status: | HPUB -- hold until publication | | Title: | Structure of an activated, truncated human 60 kDa lysophospholipase mutant at 2.5 A resolution | | Authors: | Rabe von Pappenheim, F., Tittmann, K. | | Deposition date: | 2025-08-05 |
|
| PDBID: | 9s7r | | Status: | HPUB -- hold until publication | | Title: | Structure of the de novo protein scaffold MID1sc9_4xE | | Authors: | Klassen, R., Heider, A., Kugler, H., Groll, M., Zeymer, C. | | Deposition date: | 2025-08-05 | | Sequence: | >Entity 1
GGMGPLAQQIKNTLTFIGQANAAGRMDEVRTLQENLEPLWEEYFQQTEGSGGSPLAQQIEYGEVLIEQARAAGRMDEVRRLSENTLQLMKEYFQQSD
|
|
| PDBID: | 9s7x | | Status: | HPUB -- hold until publication | | Title: | Amuc0121_S1_15 in complex with D-Galactose | | Authors: | Dey, D., Cartmell, A. | | Deposition date: | 2025-08-05 |
|
| PDBID: | 9s85 | | Status: | HPUB -- hold until publication | | Title: | Amuc0121_S1_15 in complex with O6 sulfated D-Galactose | | Authors: | Dey, D., Cartmell, A. | | Deposition date: | 2025-08-05 |
|
| PDBID: | 9s88 | | Status: | HPUB -- hold until publication | | Title: | Amuc0121_S1_15 in complex with O6 sulfated Lewis A antigen (6''S-LeA) | | Authors: | Dey, D., Cartmell, A. | | Deposition date: | 2025-08-05 |
|
| PDBID: | 9s8a | | Status: | HPUB -- hold until publication | | Title: | Amuc0451_S1_20 | | Authors: | Dey, D., Cartmell, A. | | Deposition date: | 2025-08-05 |
|
| PDBID: | 9s8f | | Status: | HPUB -- hold until publication | | Title: | Amuc1755_S1_16 in complex with D-Galactose | | Authors: | Dey, D., Cartmell, A. | | Deposition date: | 2025-08-05 |
|
| PDBID: | 9s8y | | Status: | PROC -- to be processed | | Title: | Amuc1074_S1_11 in complex with N-acetyl D-glucosamine | | Authors: | Dey, D., Cartmell, A. | | Deposition date: | 2025-08-05 |
|
| PDBID: | 9s8x | | Status: | HPUB -- hold until publication | | Title: | Amuc0953_S1_20 in complex with D-Galactose | | Authors: | Dey, D., Cartmell, A. | | Deposition date: | 2025-08-05 |
|
| PDBID: | 9w6o | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of a stacked human nucleosome core particle dimer (type 6, top NCP) assembled with DNA truncated at SHL-5.5 | | Authors: | Mu, Z., Huang, J. | | Deposition date: | 2025-08-05 |
|
| PDBID: | 9w6t | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of a stacked human nucleosome core particle dimer (type 5) assembled with DNA truncated at SHL-5.5 | | Authors: | Mu, Z., Huang, J. | | Deposition date: | 2025-08-05 |
|
| PDBID: | 9w71 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of a stacked human nucleosome core particle dimer (type 6) assembled with DNA truncated at SHL-5.5 | | Authors: | Mu, Z., Huang, J. | | Deposition date: | 2025-08-05 |
|
| PDBID: | 9w6y | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of L-galactose dehydrogenase from Luteolibacter sp. LG18 | | Authors: | Koubara, K., Takenoya, M., Suzuki, M., Ito, S., Sasaki, Y., Nakamura, A., Yajima, S. | | Deposition date: | 2025-08-05 |
|
| PDBID: | 9w72 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of a stacked human nucleosome core particle dimer (type 1) assembled with DNA truncated at SHL-5.5 | | Authors: | Mu, Z., Huang, J. | | Deposition date: | 2025-08-05 |
|
| PDBID: | 9w73 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of a stacked human nucleosome core particle dimer (type 2) assembled with DNA truncated at SHL-5.5 | | Authors: | Mu, Z., Huang, J. | | Deposition date: | 2025-08-05 |
|
| PDBID: | 9pw3 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of renal amyloid fibril from a variant apolipoprotein A-I R173P amyloidosis patient | | Authors: | Nguyen, B.A., Saelices, L. | | Deposition date: | 2025-08-04 |
|
| PDBID: | 9pwl | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Characterization of an archaeal Class I 3-hydroxy-3-methylglutaryl-CoA reductase (HMGR) from Methanobrevibacter ruminantium | | Authors: | Schofield, L., Ronimus, R., Sutherland-Smith, A.J., Carbone, V. | | Deposition date: | 2025-08-04 |
|
| PDBID: | 9s76 | | Status: | HPUB -- hold until publication | | Title: | Structure of protein kinase CK2alpha mutant Y50C associated with the Okur-Chung Neurodevelopmental Syndrome | | Authors: | Werner, C., Gast, A., Jose, J., Niefind, K. | | Deposition date: | 2025-08-04 |
|
