PDBID: | 8tl3 | Status: | HPUB -- hold until publication | Title: | CRYO-EM STRUCTURE OF HIV-1 BG505DS-SOSIP.664 ENV TRIMER BOUND TO DJ85-d.01 FAB | Authors: | Pletnev, S., Hoyt, F., Fischer, E., Kwong, P. | Deposition date: | 2023-07-26 |
|
PDBID: | 8tl4 | Status: | HPUB -- hold until publication | Title: | CRYO-EM STRUCTURE OF HIV-1 BG505DS-SOSIP.664 ENV TRIMER BOUND TO DJ85-e.01 FAB | Authors: | Pletnev, S., Hoyt, F., Fischer, E., Kwong, P. | Deposition date: | 2023-07-26 |
|
PDBID: | 8tkc | Status: | HPUB -- hold until publication | Title: | CRYO-EM STRUCTURE OF HIV-1 BG505DS-SOSIP.664 ENV TRIMER BOUND TO DJ85-b.01 FAB | Authors: | Pletnev, S., Hoyt, F., Fischer, E., Kwong, P. | Deposition date: | 2023-07-25 |
|
PDBID: | 8py2 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of the human BRISC dimer complex bound to compound JMS-175-2 | Authors: | Chandler, F., Zeqiraj, E. | Deposition date: | 2023-07-24 | Release date: | 2025-01-24 |
|
PDBID: | 8py0 | Status: | HPUB -- hold until publication | Title: | Sensor domain of Oscillibacter ruminantium chemoreceptor in complex with formate. | Authors: | Gavira, J.A., Krell, T., Monteagudo-Cascales, E., Velando, F., Matilla, M.A., Martinez-Rodriguez, S. | Deposition date: | 2023-07-24 | Release date: | 2025-01-24 |
|
PDBID: | 8py1 | Status: | HPUB -- hold until publication | Title: | Sensor domain of Asticcacaulis benevestitus chemoreceptor in complex with formate. | Authors: | Gavira, J.A., Krell, T., Monteagudo-Cascales, E., Velando, F., Matilla, M.A., Martinez-Rodriguez, S. | Deposition date: | 2023-07-24 | Release date: | 2025-01-24 |
|
PDBID: | 8pvy | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of the human BRISC dimer complex bound to compound FX-171-C | Authors: | Chandler, F., Zeqiraj, E. | Deposition date: | 2023-07-18 | Release date: | 2025-01-18 |
|
PDBID: | 8t7r | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of human leukocyte antigen A*0101 in complex with the Fab of alloreactive antibody E07 | Authors: | Green, T.J., Killian Jr, J.T., Qiu, S., Macon, K.J., Yang, G., King, R.G., Lund, F.E. | Deposition date: | 2023-06-21 | Release date: | 2024-12-21 |
|
PDBID: | 8phm | Status: | HPUB -- hold until publication | Title: | Oxalate-bound cobalt(II) human carbonic anhydrase II | Authors: | Gigli, L., Malanho Silva, J., Cerofolini, L., Macedo, A.L., Geraldes, C.F.G.C., Suturina, E.A., Calderone, V., Fragai, M., Parigi, G., Ravera, E., Luchinat, C. | Deposition date: | 2023-06-20 | Release date: | 2024-12-20 | Sequence: | >Entity 1 NWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
PDBID: | 8t5d | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM studies of the interplay between uS2 ribosomal protein and leaderless mRNA during bacterial translation initiation | Authors: | Bhattacharjee, S., Gottesman, M.E., Frank, J. | Deposition date: | 2023-06-13 |
|
PDBID: | 8t5h | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM studies of the interplay between uS2 ribosomal protein and leaderless mRNA during bacterial translation initiation | Authors: | Bhattacharjee, S., Gottesman, M.E., Frank, J. | Deposition date: | 2023-06-13 |
|
PDBID: | 8t38 | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Hypomethylated yeast 80S from high OD cells bound with E site tRNA from composite map | Authors: | Zhao, Y., Li, H. | Deposition date: | 2023-06-07 | Release date: | 2024-12-11 |
|
PDBID: | 8p8l | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of the nucleosome-bound human BCL7A | Authors: | Martin, F., Bergamin, E. | Deposition date: | 2023-06-01 | Release date: | 2024-12-01 |
|
PDBID: | 8szm | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of E. coli ClpP protease in complex with phosphine oxide compound ACP6-12 | Authors: | Mabanglo, M.F., Houry, W.A. | Deposition date: | 2023-05-30 | Release date: | 2024-11-20 |
|
PDBID: | 8syz | Status: | HPUB -- hold until publication | Title: | Rat cytosolic PEPCK in complex with GDP and phosphoglycolic acid (273K) | Authors: | McLeod, M.J., Barwell, S.A.E., Holyoak, T., Thorne, R.E. | Deposition date: | 2023-05-26 | Release date: | 2024-11-20 |
|
PDBID: | 8syr | Status: | HPUB -- hold until publication | Title: | Rat cytosolic PEPCK in complex with GTP and beta-sulfopyruvate (273K) | Authors: | McLeod, M.J., Barwell, S.A.E., Holyoak, T., Thorne, R.E. | Deposition date: | 2023-05-26 | Release date: | 2024-11-20 |
|
PDBID: | 8syy | Status: | HPUB -- hold until publication | Title: | Rat cytosolic PEPCK in complex with GDP and phosphoglycolic acid (253K) | Authors: | McLeod, M.J., Barwell, S.A.E., Holyoak, T., Thorne, R.E. | Deposition date: | 2023-05-26 | Release date: | 2024-11-20 |
|
PDBID: | 8p0i | Status: | HPUB -- hold until publication | Title: | Crystal structure of the open conformation of insulin-regulated aminopeptidase in complex with a small-MW inhibitor | Authors: | Mpakali, A., Giastas, P., Stratikos, E. | Deposition date: | 2023-05-10 | Release date: | 2024-11-10 |
|
PDBID: | 8se3 | Status: | HPUB -- hold until publication | Title: | Structure of Full-length Human Protein Kinase C Beta 1 (PKCBI) in the Active Conformation | Authors: | Cong, A.T.Q., Witter, T.L., Bruinsma, E.S., Jayaraman, S., Hawse, J.R., Goetz, M.P., Schellenberg, M.J. | Deposition date: | 2023-04-07 | Release date: | 2024-10-07 |
|
PDBID: | 8gdt | Status: | HPUB -- hold until publication | Title: | Heligmosomoides polygyrus TGF-beta Mimic 6 Domain 3 (TGM6-D3) Bound to Human TGF-beta Type II Receptor Extracellular Domain | Authors: | White, S.E., Schwartze, T.A., Hinck, A.P. | Deposition date: | 2023-03-06 | Release date: | 2024-09-11 |
|
PDBID: | 8gcg | Status: | AUCO -- author corrections pending review | Title: | MDM2 bound to inhibitor | Authors: | Silvestri, A.P., Muir, E.W., Chakka, S.K., Tripathi, S.M., Rubin, S.M., Pye, C.R., Schwochert, J.A. | Deposition date: | 2023-03-01 |
|
PDBID: | 8e8n | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | GSTZ1A in conjugation with glutathione | Authors: | McKenna, R., Combs, J.E. | Deposition date: | 2022-08-25 |
|
PDBID: | 7bce | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Notum Fragment 718 | Authors: | Zhao, Y., Jones, E.Y. | Deposition date: | 2020-12-19 |
|
PDBID: | 4qou | Status: | POLC -- waiting for a policy decision | Title: | X-ray solution structure of human immunoglobulin G1 6a in PBS-137 | Authors: | Hui, G.K., Rayner, L.E., Gor, J., Heenan, R.K., Dalby, P.A., Perkins, S.J. | Deposition date: | 2014-06-20 |
|
PDBID: | 4qov | Status: | POLC -- waiting for a policy decision | Title: | X-ray solution structure of human immunoglobulin G1 19a in PBS-137 | Authors: | Hui, G.K., Rayner, L.E., Gor, J., Heenan, R.K., Dalby, P.A., Perkins, S.J. | Deposition date: | 2014-06-20 |
|