| PDBID: | 8wd9 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Mycobacterium tuberculosis DppABCD in apo form | | Authors: | Hu, T., Zhang, B., Rao, Z. | | Deposition date: | 2023-09-14 |
|
| PDBID: | 8wda | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the substrate-bound DppABCD complex | | Authors: | Hu, T., Zhang, B., Rao, Z. | | Deposition date: | 2023-09-14 |
|
| PDBID: | 8wdb | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the ATP-bound DppABCD complex | | Authors: | Hu, T., Zhang, B., Rao, Z. | | Deposition date: | 2023-09-14 |
|
| PDBID: | 8u5w | | Status: | HPUB -- hold until publication | | Title: | De novo designed pentameric helical bundle protein | | Authors: | Bick, M.J., Xu, C., Sankaran, B., Baker, D. | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qj6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of cytochrome domain 1 from PgcA | | Authors: | Nash, B.W., Edwards, M.J., Clarke, T.A. | | Deposition date: | 2023-09-12 | | Release date: | 2024-12-12 |
|
| PDBID: | 8u59 | | Status: | HPUB -- hold until publication | | Title: | EcDsbA soaked with N-(2-fluorophenyl)-5-methylisoxazole-3-carboxamide and N-(4-(thiophen-3-yl)benzyl)cyclohexanamine | | Authors: | Wang, G., Heras, B. | | Deposition date: | 2023-09-12 | | Sequence: | >Entity 1
AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEKK
|
|
| PDBID: | 8u5o | | Status: | HPUB -- hold until publication | | Title: | The structure of the catalytic domain of NanI sialdase in complex with Neu5Gc | | Authors: | Medley, B.J., Low, K.E., Garber, J.M., Gray, T.E., Liu, L., Klassen, L., Fordwour, O.B., Inglis, G.D., Boons, G.J., Zandberg, W.F., Abbott, W.D., Boraston, A.B. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8qi0 | | Status: | HPUB -- hold until publication | | Title: | 340A Vipp1 H1-6 helical tubes | | Authors: | Junglas, B., Sachse, C. | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8u52 | | Status: | HPUB -- hold until publication | | Title: | Co-crystal structure of human transthyretin conjugated to the stilbene substructure derived from reaction with the fluorogenic covalent kinetic stabilizer A2 | | Authors: | Yan, N.L., Nugroho, K., Kline, G.M., Basanta, B., Lander, G.C., Wilson, I.A., Kelly, J.W. | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8wa4 | | Status: | HPUB -- hold until publication | | Title: | Solution structure of free ATF4 promoter G-quadruplex | | Authors: | Liu, Y.S., Wang, K.B. | | Deposition date: | 2023-09-07 |
|
| PDBID: | 8u1y | | Status: | HPUB -- hold until publication | | Title: | E.coli DsbA in complex with N-(4-(thiophen-3-yl)benzyl)cyclohexanamine | | Authors: | Wang, G., Heras, B. | | Deposition date: | 2023-09-04 | | Sequence: | >Entity 1
AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEKK
|
|
| PDBID: | 8w7e | | Status: | HPUB -- hold until publication | | Title: | Design, synthesis and biological evaluations of novel small molecular hyper-activators of human caseinolytic peptidase P (hClpP) | | Authors: | Jiang, J.-X., Ding, H., Chen, M.-R., Lu, M.-L., Sun, H.-Y., Xiao, Y.-B. | | Deposition date: | 2023-08-30 |
|
| PDBID: | 8w7g | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of cytochrome P450 CYP161H12 from Amycolatopsis pretoriensis | | Authors: | Dong, L.B., Zhang, X.W., Pan, X.M., Li, F.R. | | Deposition date: | 2023-08-30 | | Sequence: | >Entity 1
HHHHHHMTTTEETPRLPFARANALAIAPDYEVLRSRAPISRVLTPAGDPAWLVTSYEEAKEVFRDKRFGRSHPAPEQASRISNAAIQDGPSGDFETEEAEHKRMRRMLAPAFSAPRMRALGDRIAELTDRCLDDLQAAHDANPGAPVDLTDFLAFPLPVLVICELLGVPYADREHFRGLSERIARMDGGEDAQAAMAEFKAYMLKLAEAKRADPQPDVISDLVAVQADDPTFTDDDLSRMATGLLFAGHETTSTRIAMGTLFLLSDTARRDRFAADPDGEVNQTVEEILRLTATSGTGLLRYAHEDVEIAGTRIRRGDAVLVSSDAANRDASVFADPDEFDPGRTPNVHLAFGTGAHVCIGANLARTELRTVFPKLFRRFPGLRLAAGIEDVPVRVNRVAGGVDAVPVTWHHHHHH
|
|
| PDBID: | 8w7c | | Status: | HPUB -- hold until publication | | Title: | Activation of mitochondrial Caseinolytic Protease P (ClpP) induces selective cancer cell lethality | | Authors: | Jiang, J.-X., Ding, H., Lu, M.-L., Chen, M.-R., Sun, H.-Y., Xiao, Y.-B. | | Deposition date: | 2023-08-30 |
|
| PDBID: | 8u0r | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of protein A21, a component of the conserved poxvirus entry-fusion complex | | Authors: | Diesterbeck, U., Gittis, A.G., Garboczi, D.N., Moss, B. | | Deposition date: | 2023-08-29 |
|
| PDBID: | 8w69 | | Status: | HPUB -- hold until publication | | Title: | DegQ-b-casein complex | | Authors: | Lee, I.-G., Jeon, H. | | Deposition date: | 2023-08-28 |
|
| PDBID: | 8w5l | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Qb-Ab16 | | Authors: | Bao, K.Y., Li, R.H., Hua, Z.L., Hou, B.D., Zhu, P. | | Deposition date: | 2023-08-27 | | Release date: | 2025-02-27 |
|
| PDBID: | 8w5m | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Qb-Ab17 | | Authors: | Bao, K.Y., Li, R.H., Hua, Z.L., Hou, B.D., Zhu, P. | | Deposition date: | 2023-08-27 | | Release date: | 2025-02-27 |
|
| PDBID: | 8w5n | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Qb-Ab21 | | Authors: | Bao, K.Y., Li, R.H., Hua, Z.L., Hou, B.D., Zhu, P. | | Deposition date: | 2023-08-27 | | Release date: | 2025-02-27 |
|
| PDBID: | 8w5o | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Qb-Ab31 | | Authors: | Bao, K.Y., Li, R.H., Hua, Z.L., Hou, B.D., Zhu, P. | | Deposition date: | 2023-08-27 | | Release date: | 2025-02-27 |
|
| PDBID: | 8w5p | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Qb-Ab40 | | Authors: | Bao, K.Y., Hua, Z.L., Hou, B.D., Zhu, P. | | Deposition date: | 2023-08-27 | | Release date: | 2025-02-27 |
|
| PDBID: | 8w5q | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Qb-Ab45 | | Authors: | Bao, K.Y., Li, R.H., Hua, Z.L., Hou, B.D., Zhu, P. | | Deposition date: | 2023-08-27 | | Release date: | 2025-02-27 |
|
| PDBID: | 8w5r | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Qb-Ab53 | | Authors: | Bao, K.Y., Li, R.H., Hua, Z.L., Hou, B.D., Zhu, P. | | Deposition date: | 2023-08-27 | | Release date: | 2025-02-27 |
|
| PDBID: | 8w5u | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of QbN10F-Ab40 | | Authors: | Bao, K.Y., Li, R.H., Hou, B.D., Zhu, P. | | Deposition date: | 2023-08-27 | | Release date: | 2025-02-27 |
|
| PDBID: | 8w5v | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of QbN10K-Ab40 | | Authors: | Bao, K.Y., Li, R.H., Hua, Z.L., Hou, B.D. | | Deposition date: | 2023-08-27 | | Release date: | 2025-02-27 |
|
