PDBID: | 9ln7 | Status: | HPUB -- hold until publication | Title: | Alpha-7 nicotinic acetylcholine receptor bound to inhibitory bicyclic peptide KP2007 in a resting state. | Authors: | Chen, H., Sun, D., Tian, C. | Deposition date: | 2025-01-20 |
|
PDBID: | 9mxo | Status: | HPUB -- hold until publication | Title: | Motif2-Motif1 Left-handed parallel G-quadruplex in H3 Spacegroup | Authors: | Hendrickson, A.D., Xing, E.R., Yatsunyk, L.A. | Deposition date: | 2025-01-20 |
|
PDBID: | 9mxu | Status: | HPUB -- hold until publication | Title: | cryo-EM structure of GLP-1R-Gs complex with glucagon | Authors: | Zhang, X., Belousoff, M.J., Wootten, D., Sexton, P.M. | Deposition date: | 2025-01-20 |
|
PDBID: | 9lmm | Status: | HPUB -- hold until publication | Title: | An antibiotic biosynthesis monooxygenase family protein from Streptomyces sp. MA37 | Authors: | Jiang, K., Qu, X.D. | Deposition date: | 2025-01-19 |
|
PDBID: | 9mxd | Status: | AUTH -- processed, waiting for author review and approval | Title: | Human E104A calmodulin:MLCK RM20 complex | Authors: | Brunzelle, J.S., Shuvalova, L., Watterson, D.M. | Deposition date: | 2025-01-19 |
|
PDBID: | 9lm6 | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM structure of prefusion-stabilized RSV F (DS-Cav1 strain: A2) in complex with nanobody 1D8 | Authors: | Wang, Q.Q., Ke, X.L., Li, E.T., Hong, D.X., Li, H.X., Cheng, Z.K., Zhang, J.C., Jin, T.C., Shu, B., Chiu, S. | Deposition date: | 2025-01-18 | Release date: | 2026-01-18 |
|
PDBID: | 9lm5 | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM structure of prefusion-stabilized RSV F (DS-Cav1 strain: A2) in complex with nanobody 2A5 | Authors: | Wang, Q.Q., Ke, X.L., Li, E.T., Hong, D.X., Li, H.X., Cheng, Z.K., Zhang, J.C., Jin, T.C., Shu, B., Chiu, S. | Deposition date: | 2025-01-18 | Release date: | 2026-01-18 |
|
PDBID: | 9lm4 | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM structure of prefusion-stabilized RSV F (DS-Cav1 strain: A2) in complex with nanobody 2A5 | Authors: | Wang, Q.Q., Ke, X.L., Li, E.T., Hong, D.X., Li, H.X., Cheng, Z.K., Zhang, J.C., Jin, T.C., Shu, B., Chiu, S. | Deposition date: | 2025-01-18 | Release date: | 2026-01-18 |
|
PDBID: | 9lm7 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structrue of wuRFP-Pr1-88. | Authors: | Guangming, D., Zehui, X., Longxing, C. | Deposition date: | 2025-01-18 |
|
PDBID: | 9lma | Status: | HPUB -- hold until publication | Title: | Crystal structure of Ornithine decarboxylase H346A mutant without PLP | Authors: | Kim, D.S., Park, J.H., Adiko, N.N., Seo, H.T. | Deposition date: | 2025-01-18 |
|
PDBID: | 9lm8 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of wuRFP-Pfr21 | Authors: | Guangming, D., Zehui, X., Longxing, C. | Deposition date: | 2025-01-18 |
|
PDBID: | 9lm9 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of wuRFP-Pfr16-v34 | Authors: | Guangming, D., Zehui, X., Longxing, C. | Deposition date: | 2025-01-18 |
|
PDBID: | 9ll6 | Status: | HPUB -- hold until publication | Title: | Crystal structure of Ornithine decarboxylase H216F mutant without PLP | Authors: | Kim, D.S., Park, J.H., Adiko, N.N., Seo, H.T. | Deposition date: | 2025-01-17 |
|
PDBID: | 9ll3 | Status: | HPUB -- hold until publication | Title: | X-ray structure of Enterobacter cloaca transaldolase in complex with D-fructose-6-phosphate. | Authors: | Kamitori, S. | Deposition date: | 2025-01-17 | Sequence: | >Entity 1 MGSSHHHHHHSSGLVPRGSHSMELYLDTSDVAAVKKLARIFPLAGVTTNPSIVAAGKTPLDELLPALHDALGGKGRLFAQVMATTAEGMVEDARKLRAIINDLVVKVPVTVEGLAAIKMLKAEGIPTLGTAVYGAAQGMLSALAGAEYVAPYVNRVDAQGGDGIQTVIELQQLLTLHAPQSKVLAASFKTPRQALDCLLAGCESITLPLDVAQQFITSPAVDAAIVKFEQDWQGAFGRTSI
|
|
PDBID: | 9llm | Status: | HPUB -- hold until publication | Title: | Structure of C-Terminal of AB40 Peptide containing GXXXG Motif in SDS Micelles | Authors: | Sarkar, D., Bhunia, A. | Deposition date: | 2025-01-17 |
|
PDBID: | 9lls | Status: | HPUB -- hold until publication | Title: | Crystal structure of Ornithine decarboxylase H346A mutant | Authors: | Kim, D.S., Park, J.H., Adiko, N.N., Seo, H.T. | Deposition date: | 2025-01-17 |
|
PDBID: | 9mx6 | Status: | HPUB -- hold until publication | Title: | Apo EcHerA Pentamer Assembly | Authors: | Rish, A.D., Fu, T., Fosuah, E. | Deposition date: | 2025-01-17 |
|
PDBID: | 9mx7 | Status: | HPUB -- hold until publication | Title: | Apo EcHerA Tetramer Assembly | Authors: | Rish, A.D., Fu, T., Fosuah, E. | Deposition date: | 2025-01-17 |
|
PDBID: | 9lkg | Status: | HPUB -- hold until publication | Title: | Ornithine decarboxylase from Lacticaseibacillus rhamnosus | Authors: | Kim, D.S., Park, J.H., Adiko, N.N., Seo, H.T. | Deposition date: | 2025-01-16 |
|
PDBID: | 9liv | Status: | HPUB -- hold until publication | Title: | The cryo-EM structure of amyloid fibrils from abdominal fat of an AL amyloidosis patient (case 1) - polymorph 1. | Authors: | Yao, Y.X., Zhao, Q.Y., Liu, C., Li, D. | Deposition date: | 2025-01-14 |
|
PDBID: | 9liw | Status: | HPUB -- hold until publication | Title: | The cryo-EM structure of amyloid fibrils from heart of an AL amyloidosis patient (case 1) - polymorph 1. | Authors: | Yao, Y.X., Zhao, Q.Y., Liu, C., Li, D. | Deposition date: | 2025-01-14 |
|
PDBID: | 9lix | Status: | HPUB -- hold until publication | Title: | The cryo-EM structure of amyloid fibrils from abdominal fat of an AL amyloidosis patient (case 2) - polymorph 1. | Authors: | Yao, Y.X., Zhao, Q.Y., Liu, C., Li, D. | Deposition date: | 2025-01-14 |
|
PDBID: | 9liy | Status: | HPUB -- hold until publication | Title: | The cryo-EM structure of amyloid fibrils from abdominal fat of an AL amyloidosis patient (case 2) - polymorph 2. | Authors: | Yao, Y.X., Zhao, Q.Y., Liu, C., Li, D. | Deposition date: | 2025-01-14 |
|
PDBID: | 9lj0 | Status: | HPUB -- hold until publication | Title: | The cryo-EM structure of amyloid fibrils from abdominal fat of an AL amyloidosis patient (case 3). | Authors: | Yao, Y.X., Zhao, Q.Y., Liu, C., Li, D. | Deposition date: | 2025-01-14 |
|
PDBID: | 9ljc | Status: | HPUB -- hold until publication | Title: | The cryo-EM structure of amyloid fibrils from abdominal fat of a multiple myeloma patient (case 2). | Authors: | Yao, Y.X., Zhao, Q.Y., Liu, C., Li, D. | Deposition date: | 2025-01-14 |
|