| PDBID: | 9cg0 | | Status: | HPUB -- hold until publication | | Title: | Human DJ-1, 30 sec mixing with methylglyoxal, pink beam time-resolved serial crystallography | | Authors: | Zielinski, K.A., Dolamore, C., Dalton, K., Meisburger, S.P., Smith, N., Termini, J., Henning, R., Srajer, V., Hekstra, D., Pollack, L., Wilson, M.A. | | Deposition date: | 2024-06-28 |
|
| PDBID: | 9cga | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-28 |
|
| PDBID: | 9cgb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-28 |
|
| PDBID: | 9cgd | | Status: | HPUB -- hold until publication | | Title: | Human DJ-1, 10 sec mixing with methylglyoxal, pink beam time-resolved serial crystallography, CrystFEL processed | | Authors: | Zielinski, K., Dolamore, C., Dalton, K., Meisburger, S., Smith, N., Termini, J., Henning, R., Srajer, V., Hekstra, D., Pollack, L., Wilson, M.A. | | Deposition date: | 2024-06-28 |
|
| PDBID: | 9cge | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-28 |
|
| PDBID: | 9cgf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-28 |
|
| PDBID: | 9cgg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-28 |
|
| PDBID: | 9fvl | | Status: | HPUB -- hold until publication | | Title: | Characterization of multiple binding sites on microtubule associated protein 2c recognized by dimeric and monomeric 1433 zeta | | Authors: | Narasimhan, S., Jansen, S., Zidek, L. | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9fvj | | Status: | HPUB -- hold until publication | | Title: | Xenopus borealis undecorated microtubule - 15 protofilament, 3-start helix | | Authors: | Troman, L.A., Moores, C.A. | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9fvh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9fvi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9fvg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9fvf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9fvm | | Status: | HPUB -- hold until publication | | Title: | Ternary complex of HER2/ErbB2 extracellular domain (ECD) in compact conformation with trastuzumab (TZB) antibody | | Authors: | Gragera, M., Buschiazzo, A., Vacca, S. | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9fvn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9fvp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9fvq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9fvk | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-06-27 | | Release date: | 2025-06-27 |
|
| PDBID: | 9ikk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9ike | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of CDK12/Cyclin K in complex with covalent inhibitor | | Authors: | Huang, W.X., Zhou, K.J., Yang, J.Z., Ding, K. | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9ikf | | Status: | HPUB -- hold until publication | | Title: | Bovine Heart Cytochrome c Oxidase in the Carbon Dioxide-bound Fully Oxidized State | | Authors: | Muramoto, K., Shinzawa-Itoh, K. | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9ikg | | Status: | HPUB -- hold until publication | | Title: | Bovine Heart Cytochrome c Oxidase in the Carbon Dioxide-bound Fully Reduced State | | Authors: | Muramoto, K., Shinzawa-Itoh, K. | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9ikh | | Status: | HPUB -- hold until publication | | Title: | Bovine Heart Cytochrome c Oxidase in the Nitrous Oxide-bound Fully Oxidized State | | Authors: | Muramoto, K., Ide, T., Shinzawa-Itoh, K. | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9iki | | Status: | HPUB -- hold until publication | | Title: | Bovine Heart Cytochrome c Oxidase in the Nitrous Oxide-bound Fully Reduced State | | Authors: | Muramoto, K., Ide, T., Shinzawa-Itoh, K. | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9ikb | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of heterotrimeric Kinesin-2 | | Authors: | Ren, J., Zhao, L., Feng, W. | | Deposition date: | 2024-06-27 | | Sequence: | >Entity 1
HHHHSQDGGAYSDERQDLDQTIAEVSKELKLKLLIVENFIPRDVSERIKERAEWNEDSFEWNVNAFQSTSSNSSTPLNNTIEVNEDGVFTRSSGADSGVSVSGGNGTPATSQFLDKRLVATPGCRRPMSMCERMLVETAREQFGAQRRPPISGSGSFVEATIPEETIRFCGENVVVFSALERFVPEVTDSDPSTFSNSMMMSARRPSIENLTIDASKVLVPILNQSTMILKNSKNGQARNDTMPPNGSMRRSQN
>Entity 2
EDHQRQVEAMLDDIRQLRKELLLNIAIIDEYIPVEHVELIEKYVSWSEEHGDWQLKAIAYTGNNMRASAPPAKKEFSNNNQTVPMYYSYRADLGASTAEHRPRTSSKKHRASIRLQQLLT
>Entity 3
ELGKIDEYIECFYGETSVEKNKGAVALYELSKNPQNLTQLVNNETLMMALARVFREDWKKHFEVGTNIMNLFVNISKFSCLHGILLHHKIGTLCVNAMEHETKRYDFWIAEMKKTDQETLRKLKTAIRKQAMLLAACVTFLTNLATDISVELKMVRRNLVALLVKCLQMSSESTSSLTTATIKFLLKLSIFDENKIVMEQNGTIEKLLKLFPIQDPELRKAVIMLLFNFSFDSKNLPKMVNGGLVPHMASLLDSDTKALNMMYLLSCNDDAKAMLAYTDAIKLLMKDVLSGTGSEVTKAVLLNICLEKRNAQLVCGQRGQGLDLLMEMSINSRDLMLIKVVRAISSHEGATQNMFLKWIETLIGIAKNEGADNSESKSSFGLECMGTVAELKVAPWAKIIQSENLVPWMKTQLQEGIDESEEVTVLRDIKPLQLQIVIACGTMARQLDAARLLAPLIDTFVQLLQSCQIDDEFVVQLLYVFLQFLKHKELSARLMTQDSALGAHMIDLMHDANAVVREVCDNALLIMGEHSKEWAKRIAGERFKWHNAQWLEMVERDDSEFVDYDDEDFGADLKFDHYDDGFDMNEPLF
|
|
