| PDBID: | 8u65 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of PsBphP in Pfr state, splayed PSM only | | Authors: | Basore, K., Burgie, E.S., Vierstra, D. | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8u5l | | Status: | HPUB -- hold until publication | | Title: | MAU868, a novel human-derived monoclonal neutralizing antibody targeting BK virus VP1 | | Authors: | Knapp, M.S., Ornelas, E. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8u5o | | Status: | HPUB -- hold until publication | | Title: | The structure of the catalytic domain of NanI sialdase in complex with Neu5Gc | | Authors: | Medley, B.J., Low, K.E., Garber, J.M., Gray, T.E., Liu, L., Klassen, L., Fordwour, O.B., Inglis, G.D., Boons, G.J., Zandberg, W.F., Abbott, W.D., Boraston, A.B. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8u4y | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of SARS-CoV-2 Main Protease (Mpro) L50F Mutant | | Authors: | Kohaal, N., Lewandowski, E.M., Wang, J., Chen, Y. | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8u4x | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of PsBphP in Pr state | | Authors: | Basore, K., Burgie, E.S., Vierstra, D. | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qht | | Status: | HPUB -- hold until publication | | Title: | Leishmania braziliensis PRMT1-PRMT3 heterotetrameric complex in unliganded form. | | Authors: | Levdikov, V., Nay, E., Walrad, P., Plevin, J.M. | | Deposition date: | 2023-09-10 | | Sequence: | >Entity 1
DYYFDSYSHYGIHMEMLKDYHRTTTYRDAIWRNAYMFKDKVVLDVGCGTGILSMFAARAGARKVIGIDCSNVAVQARQIVQDNGFSDIITIIQGKVEELDLDEKVDIIISEWMGYFLLYESMLNTVLYARDRWGASDVKILPSSANMYACGITDPQYVEQKFNIWNSVNGLDFSYFKRLSYIEPLIDTVNPEQIITDIVPFFSFDINRVTEAELSFTSTFTLEAKQGDFVHAISVHFDTPFYAGHDPVVLNTSPMVPPTHWRQTVLYMFHPLIMKRGEKANFTMKCAPNPGNPRDLDISLHIDFDGELQACHYDQDFRLR
>Entity 2
SAARISSNISTIHDHQRLRAYEVIFRNVRGKTLLHLGCGMGLYSMLAARGMAKMVIGIDSSAIVDAARVVAEQNGLKNIQFIRGRLCEALHQLPSDMKFDYVLCEWMGPLLLNERVLTDALYARDHLLTESGALCPNRASLHVVAVSDYAFRLDTEDFWSNVYGFQMEPMKELVRQEVEMCAIPGSNIVSAPCLAHTIHMDTLEGLTAEETATYEAQANQAAAIRDNEEENPVEHCWVPAAVAQKGYEAAFTLSIARSATVHYLTFYLDAAFTSKTNPGANFVLAVRPGGQNNWTEVSVGLREPLPVNAGEKIQGTVRVYTPAEKGGKVTVVEVTAKTAGQVAAIETFGTYYYQSY
|
|
| PDBID: | 8qhf | | Status: | HPUB -- hold until publication | | Title: | Corynebacterium glutamicum mycoloyltransferase C acyl-enzyme intermediate | | Authors: | Li de la Sierra-Gallay, I., Lesur, E. | | Deposition date: | 2023-09-08 |
|
| PDBID: | 8u40 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of main protease of SARS-CoV-2 complexed with inhibitor | | Authors: | Chen, P., Arutyunova, E., Lu, J., Young, H.S., Lemieux, M.J. | | Deposition date: | 2023-09-08 | | Release date: | 2025-03-05 |
|
| PDBID: | 8u25 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of SARS-CoV-2 Main Protease (Mpro) L50F/E166A/L167F Triple Mutant | | Authors: | Kohaal, N., Lewandowski, E.M., Wang, J., Chen, Y. | | Deposition date: | 2023-09-05 |
|
| PDBID: | 8u1y | | Status: | HPUB -- hold until publication | | Title: | E.coli DsbA in complex with N-(4-(thiophen-3-yl)benzyl)cyclohexanamine | | Authors: | Wang, G., Heras, B. | | Deposition date: | 2023-09-04 | | Sequence: | >Entity 1
AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEKK
|
|
| PDBID: | 8u1h | | Status: | HPUB -- hold until publication | | Title: | Axle-less Bacillus sp. PS3 F1 ATPase mutant | | Authors: | Furlong, E.J., Zeng, Y.C., Brown, S.H.J., Sobti, M., Stewart, A.G. | | Deposition date: | 2023-09-01 |
|
| PDBID: | 8qdj | | Status: | HPUB -- hold until publication | | Title: | Ntaya virus methyltransferase in complex wih Sinefungin | | Authors: | Krejcova, K., Boura, E., Klima, M. | | Deposition date: | 2023-08-29 |
|
| PDBID: | 8qco | | Status: | HPUB -- hold until publication | | Title: | E.coli IspE in complex with a ligand (3) | | Authors: | Hamid, R. | | Deposition date: | 2023-08-28 |
|
| PDBID: | 8w67 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Glycogen branching enzyme (VvGBE) from Vibrio vulnificus MO6-24/O | | Authors: | An, Y., Park, J.T., Woo, E.J. | | Deposition date: | 2023-08-28 |
|
| PDBID: | 8qcn | | Status: | HPUB -- hold until publication | | Title: | E.coli IspE in complex with a ligand (2) | | Authors: | Hamid, R. | | Deposition date: | 2023-08-27 |
|
| PDBID: | 8qce | | Status: | HPUB -- hold until publication | | Title: | Dispersin from Lactiplantibacillus paraplantarum DispLp | | Authors: | Males, A., Moroz, O.V., Blagova, E., Munch, A., Hansen, G.H., Johansen, A.H., Ostergaard, L.H., Segura, D.R., Eddenden, A., Due, A.V., Gudmand, M., Salomon, J., Sorensen, S.R., Cairo, J.L.F., Pache, R.A., Vejborg, R.M., Davies, G.J., Wilson, K.S. | | Deposition date: | 2023-08-25 | | Release date: | 2025-02-25 |
|
| PDBID: | 8qcc | | Status: | HPUB -- hold until publication | | Title: | E.coli IspE in complex with a ligand (1) | | Authors: | Hamid, R. | | Deposition date: | 2023-08-25 |
|
| PDBID: | 8tyk | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of SARS-CoV-2 Main Protease (Mpro) T21I Mutant | | Authors: | Kohaal, N., Lewandowski, E.M., Wang, J., Chen, Y. | | Deposition date: | 2023-08-25 |
|
| PDBID: | 8qb6 | | Status: | HPUB -- hold until publication | | Title: | Dispersin from Terribacillus saccharophilus DispTs2 | | Authors: | Males, A., Moroz, O.V., Blagova, E., Munch, A., Hansen, G.H., Johansen, A.H., Ostergaard, L.H., Segura, D.R., Eddenden, A., Due, A.V., Gudmand, M., Salomon, J., Sorensen, S.R., Cairo, J.L.F., Pache, R.A., Vejborg, R.M., Davies, G.J., Wilson, K.S. | | Deposition date: | 2023-08-24 | | Release date: | 2025-02-28 |
|
| PDBID: | 8qak | | Status: | HPUB -- hold until publication | | Title: | Dispersin from Terribacillus saccharophilus DispTs3 | | Authors: | Males, A., Moroz, O.V., Blagova, E., Munch, A., Hansen, G.H., Johansen, A.H., Ostergaard, L.H., Segura, D.R., Eddenden, A., Due, A.V., Gudmand, M., Salomon, J., Sorensen, S.R., Cairo, J.L.F., Pache, R.A., Vejborg, R.M., Davies, G.J., Wilson, K.S. | | Deposition date: | 2023-08-22 | | Release date: | 2025-02-28 |
|
| PDBID: | 8q8i | | Status: | HPUB -- hold until publication | | Title: | AO75L in complex with a synthetic trisaccharide acceptor. | | Authors: | Laugueri, M.E., Speciale, I., Gimeno, A., Sicheng, L., Poveda, A., Lowary, T., Van Etten J, L., Barbero, J., De Castro, C., Tonetti, M., Rojas A, L. | | Deposition date: | 2023-08-18 |
|
| PDBID: | 8q7o | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the FZD3 cysteine-rich domain in complex with a nanobody (14478) | | Authors: | Hillier, J.S., Zhao, Y., Malinauskas, T., Jones, E.Y. | | Deposition date: | 2023-08-16 |
|
| PDBID: | 8ttt | | Status: | HOLD -- hold until a certain date | | Title: | Structure of SNX27 FERM complexed with Fam21A repeat 15 (1124-1140) | | Authors: | Guo, Q., Chen, K.-E., Collins, B.M. | | Deposition date: | 2023-08-15 | | Release date: | 2024-08-15 |
|
| PDBID: | 8ttu | | Status: | HOLD -- hold until a certain date | | Title: | Structure of SNX27 FERM complexed with Fam21A repeat 19 (1261 - 1274) | | Authors: | Guo, Q., Chen, K.-E., Collins, B.M. | | Deposition date: | 2023-08-15 | | Release date: | 2024-08-15 |
|
| PDBID: | 8ttv | | Status: | HOLD -- hold until a certain date | | Title: | Structure of SNX27 FERM complexed with Fam21A repeat 20 (1289-1302) | | Authors: | Guo, Q., Chen, K.-E., Collins, B.M. | | Deposition date: | 2023-08-15 | | Release date: | 2024-08-15 |
|
