Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9rwy
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of bifunctional catalase-phenol oxidase from a marine-derived Cladosporium species complexed with catechol
Authors:Kosinas, C., Ferousi, C., Pantelakis, O.I., Topakas, E., Dimarogona, M.
Deposition date:2025-07-10
PDBID:9phj
Status:HPUB -- hold until publication
Title:Three-dimensional structures of KI17 in SDS-d25 micelles
Authors:Matos, C.O., Liao, L.M.
Deposition date:2025-07-09
PDBID:9vrv
Status:HPUB -- hold until publication
Title:HosA transcriptional regulator from enteropathogenic Escherichia coli O127:H6 (strain E2348/69) bound with 4-hydroxy benzoic acid - Conformation II at 1.41 angstrom resolution
Authors:Brito, J.A., Orr, C.M., Wagner, A., Goswami, A.
Deposition date:2025-07-07
Sequence:

>Entity 1


MALRNKAFHQLRQLFQQHTARWQHELPDLTKPQYAVMRAIADKPGIEQVALIEAAVSTKATLAEMLARMENRGLVRREHDAADKRRRFVWLTAEGEKVLAAAIPIGDSVDEEFLGRLSAEEQELFMQLVRKMMNTLEHHHHHH
PDBID:9rv6
Status:AUTH -- processed, waiting for author review and approval
Title:5 micrometer HEWL crystals solved at room-temperature using fixed-target serial crystallography.
Authors:Mason, T.J., Carrillo, M., Beale, J.H., Padeste, C.
Deposition date:2025-07-07
PDBID:9rv7
Status:HPUB -- hold until publication
Title:Streptococcus pneumoniae StkP catalytic domain T167A/T169A double mutant in complex with AMP-PNP and Mg2+
Authors:Hamidi, M., Ravaud, S., Grangeasse, C.
Deposition date:2025-07-07
PDBID:9pgb
Status:HPUB -- hold until publication
Title:4-module Cysteine Rich Eggshell Membrane Protein (CREMP)
Authors:Zeinalilathori, S., Russell, R.W., Ross, J., Modla, S., Caplan, J., Polenova, T., Thorpe, C.
Deposition date:2025-07-07
PDBID:9vrf
Status:HPUB -- hold until publication
Title:Fundamental structural studies of metanaphthene and introduction of disulfide bonds
Authors:Liang, C.
Deposition date:2025-07-06
PDBID:9vr1
Status:HOLD -- hold until a certain date
Title:Crystal structure of human phospholysine phosphohistidine inorganic pyrophosphate phosphatase LHPP
Authors:Xue, S.Y., Luo, C.
Deposition date:2025-07-05
Release date:2026-07-05
PDBID:9vq5
Status:HPUB -- hold until publication
Title:Crystal structure of Peroxiredoxin I in complex with SAC
Authors:Zhu, Y.Y., Xu, H., Zhang, H., Luo, C.
Deposition date:2025-07-04
PDBID:9vq3
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of human phosphodiesterase 10A in complex with (6-fluoro-2-(1-(4-methylquinazolin-2-yl)azetidin-3-yl)imidazo[1,2-a]pyridin-3-yl)(4,7-diazaspiro[2.5]octan-7-yl)methanone
Authors:Zhang, F.C., Huang, Y.Y., Luo, H.B., Guo, L.
Deposition date:2025-07-04
PDBID:9vq6
Status:HPUB -- hold until publication
Title:Strcture of Nanobody (NB) specific to Interleukin-6
Authors:Talwar, C.S., Ahn, W.C., Lee, S.J., Woo, E.J.
Deposition date:2025-07-04
PDBID:9vq7
Status:HOLD -- hold until a certain date
Title:Crystal structure of human phospholysine phosphohistidine inorganic pyrophosphate phosphatase LHPP in complex with Ca
Authors:Xue, S.Y., Luo, C.
Deposition date:2025-07-04
Release date:2026-07-04
PDBID:9ruj
Status:HPUB -- hold until publication
Title:Streptococcus pneumoniae StkP catalytic domain T167E/T169E double mutant in complex with AMP-PNP and Mn2+
Authors:Hamidi, M., Ravaud, S., Grangeasse, C.
Deposition date:2025-07-04
PDBID:9ruk
Status:HPUB -- hold until publication
Title:Streptococcus pneumoniae StkP catalytic domain T167A/T169A double mutant in complex with AMP-PNP and Mn2+
Authors:Hamidi, M., Ravaud, S., Grangeasse, C.
Deposition date:2025-07-04
PDBID:9ru3
Status:HPUB -- hold until publication
Title:Streptococcus pneumoniae StkP catalytic domain T167A/T169A double mutant
Authors:Gueguen-Chaignon, V., Ravaud, S., Grangeasse, C.
Deposition date:2025-07-03
PDBID:9pf1
Status:HPUB -- hold until publication
Title:Nub1/Fat10-processing human 26S proteasome with Rpt4 at top of spiral staircase (AAA+ motor locally refined)
Authors:Arkinson, C., Gee, C.L., Martin, A.
Deposition date:2025-07-03
PDBID:9vpp
Status:HOLD -- hold until a certain date
Title:Structural Basis for sBCMA Resistance and Antigen Escape in Eque-cel BCMA CAR-T Cell Therapy
Authors:Li, C.
Deposition date:2025-07-03
Release date:2026-07-03
PDBID:9rtb
Status:HPUB -- hold until publication
Title:Crystal structure of the adduct formed upon reaction of [V(IV)O(acetylacetonate)2] with human serum transferrin with Fe(III) bound at the C-lobe only
Authors:Paolillo, M., Ferraro, G., Banneville, A.S., Cornaciu, I., Pica, A., Merlino, A.
Deposition date:2025-07-02
PDBID:9rtf
Status:HPUB -- hold until publication
Title:Crystal structure of the human serum transferrin with Fe(III) bound at the C-lobe only
Authors:Paolillo, M., Ferraro, G., Banneville, A.S., Cornaciu, I., Pica, A., Merlino, A.
Deposition date:2025-07-02
PDBID:9rth
Status:HPUB -- hold until publication
Title:Crystal structure of the human serum transferrin with Fe(III) bound at the C-lobe only (treated with DMSO)
Authors:Paolillo, M., Ferraro, G., Banneville, A.S., Cornaciu, I., Pica, A., Merlino, A.
Deposition date:2025-07-02
PDBID:9pew
Status:HPUB -- hold until publication
Title:Porcine ATP synthase with inhibitory protein IF1, DP-state
Authors:Mnatsakanyan, N., Mello, J.F.R., Palles, C.
Deposition date:2025-07-02
PDBID:9pex
Status:HPUB -- hold until publication
Title:Porcine ATP synthase with inhibitory protein IF1, F1 domain, E-state
Authors:Mnatsakanyan, N., Mello, J.F.R., Palles, C.
Deposition date:2025-07-02
PDBID:9pem
Status:HPUB -- hold until publication
Title:Porcine ATP synthase without inhibitory protein IF1, DP-state
Authors:Mnatsakanyan, M., Mello, J.F.R., Palles, C.
Deposition date:2025-07-02
PDBID:9rsz
Status:HPUB -- hold until publication
Title:Crystal structure of Amborella trichopoda ACCO2 in complex with Fe and ACC
Authors:Zhang, Z., Schofield, C.J.
Deposition date:2025-07-01
PDBID:9vnw
Status:HPUB -- hold until publication
Title:Crystal structure of Pyrococcus abyssi AIR synthetase with an N-terminal 54-residues deletion
Authors:Chen, Y.H., Chen, C.J.
Deposition date:2025-07-01

242842

數據於2025-10-08公開中

PDB statisticsPDBj update infoContact PDBjnumon