| PDBID: | 9wkd | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of 100 | | Authors: | Dong, C., Yuan, X., Li, J. | | Deposition date: | 2025-09-01 | | Release date: | 2026-09-01 |
|
| PDBID: | 9wke | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of 101 | | Authors: | Dong, C., Yuan, X., Li, J. | | Deposition date: | 2025-09-01 | | Release date: | 2026-09-01 |
|
| PDBID: | 9wk3 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of 46 | | Authors: | Dong, C., Yuan, X., Li, J. | | Deposition date: | 2025-09-01 | | Release date: | 2026-09-01 |
|
| PDBID: | 9wkh | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of 105 | | Authors: | Dong, C., Yuan, X., Li, J. | | Deposition date: | 2025-09-01 | | Release date: | 2026-09-01 |
|
| PDBID: | 9wk8 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of 74 | | Authors: | Dong, C., Yuan, X., Li, J. | | Deposition date: | 2025-09-01 | | Release date: | 2026-09-01 |
|
| PDBID: | 9wk5 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of 48 | | Authors: | Dong, C., Li, J., Yuan, X. | | Deposition date: | 2025-09-01 | | Release date: | 2026-09-01 |
|
| PDBID: | 9wkg | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of 104 | | Authors: | Dong, C., Yuan, X., Li, J. | | Deposition date: | 2025-09-01 | | Release date: | 2026-09-01 |
|
| PDBID: | 9wk7 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of 73 | | Authors: | Dong, C., Yuan, X., Li, J. | | Deposition date: | 2025-09-01 | | Release date: | 2026-09-01 |
|
| PDBID: | 9wkc | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of 86 | | Authors: | Dong, C., Yuan, X., Li, J. | | Deposition date: | 2025-09-01 | | Release date: | 2026-09-01 |
|
| PDBID: | 9wka | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of 81 | | Authors: | Dong, C., Yuan, X., Li, J. | | Deposition date: | 2025-09-01 | | Release date: | 2026-09-01 |
|
| PDBID: | 9wkp | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of ZYG11B bound to compound 10 | | Authors: | Dong, C., Yuan, X., Li, J. | | Deposition date: | 2025-09-01 | | Release date: | 2026-09-01 |
|
| PDBID: | 9wko | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of 49 | | Authors: | Dong, C., Yuan, X., Li, J. | | Deposition date: | 2025-09-01 | | Release date: | 2026-09-01 |
|
| PDBID: | 9wkl | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of 45 | | Authors: | Dong, C., Yuan, X., Li, J. | | Deposition date: | 2025-09-01 | | Release date: | 2026-09-01 |
|
| PDBID: | 9wkm | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of ZYG11B bound to compound 6 | | Authors: | Dong, C., Yuan, X., Li, J. | | Deposition date: | 2025-09-01 | | Release date: | 2026-09-01 |
|
| PDBID: | 9wkn | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of ZYG11B bound to compound 5 | | Authors: | Dong, C., Yuan, X., Li, J. | | Deposition date: | 2025-09-01 | | Release date: | 2026-09-01 |
|
| PDBID: | 9wl2 | | Status: | HPUB -- hold until publication | | Title: | NMR solution structure of LL-D49194-alpha-1 covalently bound to MYC G-quadruplex | | Authors: | Ni, X., Hu, X., Cao, C. | | Deposition date: | 2025-09-01 |
|
| PDBID: | 9wkk | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of 03 | | Authors: | Dong, C., Yuan, X., Li, J. | | Deposition date: | 2025-09-01 | | Release date: | 2026-09-01 |
|
| PDBID: | 9sjq | | Status: | HPUB -- hold until publication | | Title: | Single-chain chimeric protein mimicking the interaction between HR1 and HR2 in HIV gp41 (pH 6.5) | | Authors: | Camara-Artigas, A., Gavira, J.A., Conejero-Lara, F., Polo-Megias, D., Salinas-Garcia, M.C. | | Deposition date: | 2025-08-31 |
|
| PDBID: | 9sjp | | Status: | HPUB -- hold until publication | | Title: | Single-chain chimeric protein mimicking the interaction between HR1 and HR2 in HIV gp41 bound to ANS | | Authors: | Camara-Artigas, A., Gavira, J.A., Conejero-Lara, F., Polo-Megias, D., Salinas-Garcia, M.C. | | Deposition date: | 2025-08-31 |
|
| PDBID: | 9wjy | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Tti2-Tti1-C | | Authors: | Qin, Y., Xu, G. | | Deposition date: | 2025-08-31 |
|
| PDBID: | 9wjn | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of inward-open state human norepinephrine transporter NET bound with 5648160-2 | | Authors: | Tan, J., Zang, J., Xiao, Y., Yan, C. | | Deposition date: | 2025-08-31 |
|
| PDBID: | 9y1q | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Alternative NBD1-binding geometry in channel-formed, ATP-bound, VX809-bound, T2a-nanobody-bound wild-type human CFTR (Composite map from PHENIX) | | Authors: | Hunt, J.F., Paige, A.S., Govaerts, C. | | Deposition date: | 2025-08-30 |
|
| PDBID: | 9y1r | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a pi-class glutathione S-transferase 2 from Asc l | | Authors: | Pedersen, L.C., Mueller, G.A. | | Deposition date: | 2025-08-30 |
|
| PDBID: | 9y1m | | Status: | HPUB -- hold until publication | | Title: | Cryo EM Structure of Full Length mGluR8 in Complex with Beta-Arrestin-1 Bound to Agonist L-AP4 and PAM VU6005649 | | Authors: | Marx, D.C., Levitz, J.T. | | Deposition date: | 2025-08-29 |
|
| PDBID: | 9wiu | | Status: | HPUB -- hold until publication | | Title: | SbSOMT in apo state | | Authors: | Pow, K.C., Hao, Q. | | Deposition date: | 2025-08-29 | | Sequence: | >Entity 1 GSYDSSSSSSNDSSARNEEDESCMFALKLLGGFAVPFTIKAVIELGVMDQLLTAERAMSAEELVAAAVAAQLPRPEVACTMVDRLLRFLASHSVVRCTTEVVVGTDDATTTTCCRRSYAASPVCKWFARNGVEDSVLPLGMMILNKTFLDSWQNITDAVLEGAAPFEKTYGMPMFEYLSTNGPLNTVFHEAMANHSMIITKKLLKFFRGFEGLDVLVDVGGGNGTTLQMIRGQYKNMRGINYDLPHVIAQAAPVEGVEHVGGSMFDNIPRGNAVLLKWILHDWDDKACIKILKNCYTALHVRGKVIVLEYVVPDEPEPTLAAQGAFELDLTMLVTFGSGKERTQREFSELAMEAGFSREFKATYIFANVWALEFTK
|
|