Loading
PDBj
MenuPDBj@FacebookPDBj@TwitterPDBj@YouTubewwPDB FoundationwwPDB
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9bw2
Status:HPUB -- hold until publication
Title:Neutron Structure of Reduced Tyr34Phe MnSOD
Authors:Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O.
Deposition date:2024-05-20
Sequence:

>Entity 1


MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
PDBID:9bw3
Status:HPUB -- hold until publication
Title:Consensus model for preturnover condition of Bacillus subtilis ribonucleotide reductase complex
Authors:Xu, D., Thomas, W.C., Burnim, A.A., Ando, N.
Deposition date:2024-05-20
PDBID:9fed
Status:HPUB -- hold until publication
Title:Single-chain chimeric protein mimicking the interaction between HR1 and HR2 in HIV gp41
Authors:Camara-Artigas, A., Gavira, J.A., Conejero-Lara, F., Polo-Megias, D.
Deposition date:2024-05-18
PDBID:8zl7
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of Os ALDH2C4 (cytosolic aldehyde dehydrogenase) in complex with NADH
Authors:Wang, Y., Wang, W.M., Song, Z.D.
Deposition date:2024-05-17
Release date:2025-05-17
PDBID:9fd8
Status:HPUB -- hold until publication
Title:Re-engineered peroxygenase variant of 2-deoxy-D-ribose-5-phosphate aldolase, Schiff-base complex with 4-chloro-cinnamaldehyde
Authors:Thunnissen, A.M.W.H., Zhou, H., Frietema, H.O.T., Poelarends, G.J.
Deposition date:2024-05-16
PDBID:9fd9
Status:HPUB -- hold until publication
Title:Re-engineered peroxygenase variant of 2-deoxy-D-ribose-5-phosphate aldolase, Schiff-base complex with 4-nitro-cinnamaldehyde
Authors:Thunnissen, A.M.W.H., Zhou, H., Frietema, H.O.T., Poelarends, G.J.
Deposition date:2024-05-16
PDBID:9fd7
Status:HPUB -- hold until publication
Title:Re-engineered peroxygenase variant of 2-deoxy-D-ribose-5-phosphate aldolase in substrate-free state
Authors:Thunnissen, A.M.W.H., Zhou, H., Frietema, H.O.T., Poelarends, G.J.
Deposition date:2024-05-16
PDBID:9bue
Status:AUTH -- processed, waiting for author review and approval
Title:Human calcitonin Receptor in complex with Gs and cagrilintide in the CT-like conformation (repeat)
Authors:Cao, J., Belousoff, M.J., Johnson, R.M., Sexton, P.M., Wootten, D.L.
Deposition date:2024-05-16
PDBID:9btv
Status:AUTH -- processed, waiting for author review and approval
Title:Cryo-EM structure of rhesus antibody T646-a.01 in complex with HIV-1 Env Q23.17 MD39 SOSIP
Authors:Roark, R.S., Shapiro, L., Kwong, P.D.
Deposition date:2024-05-15
PDBID:9fbk
Status:HPUB -- hold until publication
Title:Diheme cytochrome c Kustd1711 from Kuenenia stuttgartiensis, without glycerol cryoprotectant
Authors:Hauser, D., Barends, T.R.M.
Deposition date:2024-05-14
PDBID:8zip
Status:HPUB -- hold until publication
Title:Mouse left ventricle actin and myosin complex
Authors:Li, D.N., Zhao, Q.Y., Liu, C.
Deposition date:2024-05-14
PDBID:8ziu
Status:HPUB -- hold until publication
Title:Mouse MYH6 R404Q left ventricle actin and myosin complex
Authors:Li, D.N., Zhao, Q.Y., Liu, C.
Deposition date:2024-05-14
PDBID:8zj1
Status:HPUB -- hold until publication
Title:Human left ventricle F-actin
Authors:Li, D.N., Zhao, Q.Y., Liu, C.
Deposition date:2024-05-14
PDBID:8zix
Status:HPUB -- hold until publication
Title:RAT skeletal muscle F-actin
Authors:Li, D.N., Zhao, Q.Y., Liu, C.
Deposition date:2024-05-14
PDBID:8zjg
Status:HPUB -- hold until publication
Title:Cryo-EM structure of human CMKLR1-Gi complex bound to chemerin
Authors:Liu, A.J., Liu, Y.Z., Ye, R.D.
Deposition date:2024-05-14
PDBID:8zi9
Status:HPUB -- hold until publication
Title:Human left ventricle actin and myosin complex
Authors:Li, D.N., Zhao, Q.Y., Liu, C.
Deposition date:2024-05-13
PDBID:9bs2
Status:HPUB -- hold until publication
Title:Glycosylase MutY variant R149Q in complex with DNA containing d(8-oxo-G) paired with a product analog (THF) to 1.51 A resolution
Authors:Trasvina-Arenas, C.H., Tamayo, N., Lin, W.J., Demir, M., Fisher, A.J., David, S.S., Horvath, M.P.
Deposition date:2024-05-12
Sequence:

>Entity 1


GSHMTRETERFPAREFQRDLLDWFARERRDLPWRKDRDPYKVWVSEVMLQQTRVETVIPYFEQFIDRFPTLEALADADEDEVLKAWEGLGYYSRVRNLHAAVKEVKTRYGGKVPDDPDEFSRLKGVGPYTVGAVLSLAYGVPEPAVDGNVMQVLSRLFLVTDDIAKPSTRKRFEQIVREIMAYENPGAFNEALIELGALVCTPRRPSCLLCPVQAYCQAFAEGVAEELPVKMKKTAVKQVPLAVAVLADDEGRVLIRKRDSTGLLANLWEFPSCETDGADGKEKLEQMVGEQYGLQVELTEPIVSFEHAFSHLVWQLTVFPGRLVHGGPVEEPYRLAPEDELKAYAFPVSHQRVWREYKEWASGVRPPP

>Entity 2


(DA)(DA)(DG)(DA)(DC)(8OG)(DT)(DG)(DG)(DA)(DC)

>Entity 3


(DT)(DG)(DT)(DC)(DC)(DA)(3DR)(DG)(DT)(DC)(DT)
PDBID:8zh7
Status:HPUB -- hold until publication
Title:Crystal structure of N-terminal domain of N-methyl-D-aspartate receptor subunit NR1 in complex with patient-derived antibody
Authors:Nomura, N., Kumazaki, K., Amano, Y.
Deposition date:2024-05-10
PDBID:9bqr
Status:HPUB -- hold until publication
Title:X-ray Structure of a Second-Sphere H-bond Deletion Mutant of a De Novo Designed Self Assembled Peptide Tetramer Featuring a Cu(His)4(H2O) Coordination Motif
Authors:Chakraborty, S., Sony, S., Prakash, D., Andi, B.
Deposition date:2024-05-10
PDBID:8zfi
Status:HPUB -- hold until publication
Title:Structure of E.coli ribosome in complex with an engineered arrest peptide and trigger factor
Authors:Sriramoju, M.K., Ko, T.P., Draczkowski, P., Hsu, S.T.D.
Deposition date:2024-05-07
PDBID:9f8a
Status:HPUB -- hold until publication
Title:Crystal structure of human monoacylglycerol lipase in complex with compound 7a
Authors:Kuhn, B., Ritter, M., Hornsperger, B., Bell, C., Kocer, B., Rombach, D., Richter, H., Grether, U., Gobbi, L., Kuratli, M., Collin, L., Benz, J.
Deposition date:2024-05-06
PDBID:9f8b
Status:HPUB -- hold until publication
Title:Crystal structure of human monoacylglycerol lipase in complex with compound 7n
Authors:Kuhn, B., Ritter, M., Hornsperger, B., Bell, C., Kocer, B., Rombach, D., Richter, H., Grether, U., Gobbi, L., Kuratli, M., Collin, L., Benz, J.
Deposition date:2024-05-06
PDBID:9f8c
Status:HPUB -- hold until publication
Title:Crystal structure of human monoacylglycerol lipase in complex with compound 7m
Authors:Kuhn, B., Ritter, M., Hornsperger, B., Bell, C., Kocer, B., Rombach, D., Richter, H., Grether, U., Gobbi, L., Kuratli, M., Collin, L., Benz, J.
Deposition date:2024-05-06
PDBID:9f8d
Status:HPUB -- hold until publication
Title:Crystal structure of human monoacylglycerol lipase in complex with compound 7i
Authors:Kuhn, B., Ritter, M., Hornsperger, B., Bell, C., Kocer, B., Rombach, D., Richter, H., Grether, U., Gobbi, L., Kuratli, M., Collin, L., Benz, J.
Deposition date:2024-05-06
PDBID:8zei
Status:HPUB -- hold until publication
Title:Crystal structure of human cytosolic beta-alanyl lysine dipeptidase with crystal soaked in beta-alanyl histidine
Authors:Chandravanshi, K., Kumar, A., Makde, R.D.
Deposition date:2024-05-06

226262

數據於2024-10-16公開中

PDB statisticsPDBj update infoContact PDBjnumon