PDBID: | 9qpn | Status: | HPUB -- hold until publication | Deposition date: | 2025-03-27 |
|
PDBID: | 9qpd | Status: | HPUB -- hold until publication | Title: | APH(2'''')-IVa with a fragment | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | Deposition date: | 2025-03-27 |
|
PDBID: | 9qpf | Status: | HPUB -- hold until publication | Title: | Solution structure of Sox2 DBD | Authors: | Orsetti, A., van Ingen, H. | Deposition date: | 2025-03-27 | Sequence: | >Entity 1 GSNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTL
|
|
PDBID: | 9u8f | Status: | HPUB -- hold until publication | Title: | The Cryo-EM Structure of Full-Length Extracellular Domain of NKp46 in Complex with OmniClic Fab and Two OmnidAb nanobodies. | Authors: | Srivastava, D.B., Zeng, B., Rivera, G., Harriman, W. | Deposition date: | 2025-03-26 |
|
PDBID: | 9u8j | Status: | HPUB -- hold until publication | Deposition date: | 2025-03-26 |
|
PDBID: | 9u8n | Status: | HPUB -- hold until publication | Deposition date: | 2025-03-26 |
|
PDBID: | 9u8o | Status: | HPUB -- hold until publication | Deposition date: | 2025-03-26 |
|
PDBID: | 9u8p | Status: | HPUB -- hold until publication | Deposition date: | 2025-03-26 |
|
PDBID: | 9u8q | Status: | HPUB -- hold until publication | Deposition date: | 2025-03-26 |
|
PDBID: | 9u8r | Status: | HPUB -- hold until publication | Title: | Crystal structure of thiamine pyrophosphate (TPP)-dependent alpha-imino acid decarboxylase (AzcB and AzcC) from Streptomyces mobaraensis in complex with TTPP and 6-amino-4-oxo-4,5-dihydro-1,3,5-triazine-2-carboxylic acid. | Authors: | Nakashima, Y., Tsunoda, T., Ogasawara, Y., Dairi, T., Morita, H. | Deposition date: | 2025-03-26 |
|
PDBID: | 9u8d | Status: | HPUB -- hold until publication | Deposition date: | 2025-03-26 |
|
PDBID: | 9u8c | Status: | HPUB -- hold until publication | Deposition date: | 2025-03-26 |
|
PDBID: | 9u8k | Status: | HPUB -- hold until publication | Deposition date: | 2025-03-26 |
|
PDBID: | 9u8g | Status: | HPUB -- hold until publication | Deposition date: | 2025-03-26 |
|
PDBID: | 9u89 | Status: | HPUB -- hold until publication | Title: | Structure of AA(GGGTT)3GGGAA G-quadruplex in the presence of potassium ions | Authors: | Negi, D., Sannapureddi, R.K.R., Sathyamoorthy, B. | Deposition date: | 2025-03-26 | Sequence: | >Entity 1 (DA)(DA)(DG)(DG)(DG)(DT)(DT)(DG)(DG)(DG)(DT)(DT)(DG)(DG)(DG)(DT)(DT)(DG)(DG)(DG)(DA)(DA)
|
|
PDBID: | 9u8e | Status: | HPUB -- hold until publication | Deposition date: | 2025-03-26 |
|
PDBID: | 9u8h | Status: | HPUB -- hold until publication | Deposition date: | 2025-03-26 |
|
PDBID: | 9u8i | Status: | HPUB -- hold until publication | Title: | cryo-EM structure of human ATP9A | Authors: | Zhu, K.F., Zhang, H.W. | Deposition date: | 2025-03-26 |
|
PDBID: | 9u8m | Status: | HPUB -- hold until publication | Title: | Drosophila melanogaster Nicotinamidase in Complex with Inhibitor CN2 | Authors: | Li, G.-B., Chen, Y.-T. | Deposition date: | 2025-03-26 |
|
PDBID: | 9u8s | Status: | HPUB -- hold until publication | Title: | Crystal structure of thiamine pyrophosphate (TPP)-dependent alpha-imino acid decarboxylase (AzcB and AzcC) from Streptomyces mobaraensis in complex with TPP and 5-azacytosine. | Authors: | Nakashima, Y., Tsunoda, T., Ogasawara, Y., Dairi, T., Morita, H. | Deposition date: | 2025-03-26 |
|
PDBID: | 9u8b | Status: | HOLD -- hold until a certain date | Deposition date: | 2025-03-26 | Release date: | 2026-03-26 |
|
PDBID: | 9u8l | Status: | HPUB -- hold until publication | Deposition date: | 2025-03-26 |
|
PDBID: | 9u8t | Status: | HPUB -- hold until publication | Deposition date: | 2025-03-26 |
|
PDBID: | 9u8u | Status: | HPUB -- hold until publication | Deposition date: | 2025-03-26 |
|
PDBID: | 9u91 | Status: | HPUB -- hold until publication | Deposition date: | 2025-03-26 |
|