| PDBID: | 9rwy | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of bifunctional catalase-phenol oxidase from a marine-derived Cladosporium species complexed with catechol | | Authors: | Kosinas, C., Ferousi, C., Pantelakis, O.I., Topakas, E., Dimarogona, M. | | Deposition date: | 2025-07-10 |
|
| PDBID: | 9phj | | Status: | HPUB -- hold until publication | | Title: | Three-dimensional structures of KI17 in SDS-d25 micelles | | Authors: | Matos, C.O., Liao, L.M. | | Deposition date: | 2025-07-09 |
|
| PDBID: | 9pgb | | Status: | HPUB -- hold until publication | | Title: | 4-module Cysteine Rich Eggshell Membrane Protein (CREMP) | | Authors: | Zeinalilathori, S., Russell, R.W., Ross, J., Modla, S., Caplan, J., Polenova, T., Thorpe, C. | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9vrv | | Status: | HPUB -- hold until publication | | Title: | HosA transcriptional regulator from enteropathogenic Escherichia coli O127:H6 (strain E2348/69) bound with 4-hydroxy benzoic acid - Conformation II at 1.41 angstrom resolution | | Authors: | Brito, J.A., Orr, C.M., Wagner, A., Goswami, A. | | Deposition date: | 2025-07-07 | | Sequence: | >Entity 1
MALRNKAFHQLRQLFQQHTARWQHELPDLTKPQYAVMRAIADKPGIEQVALIEAAVSTKATLAEMLARMENRGLVRREHDAADKRRRFVWLTAEGEKVLAAAIPIGDSVDEEFLGRLSAEEQELFMQLVRKMMNTLEHHHHHH
|
|
| PDBID: | 9rv6 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | 5 micrometer HEWL crystals solved at room-temperature using fixed-target serial crystallography. | | Authors: | Mason, T.J., Carrillo, M., Beale, J.H., Padeste, C. | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9rv7 | | Status: | HPUB -- hold until publication | | Title: | Streptococcus pneumoniae StkP catalytic domain T167A/T169A double mutant in complex with AMP-PNP and Mg2+ | | Authors: | Hamidi, M., Ravaud, S., Grangeasse, C. | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9vrf | | Status: | HPUB -- hold until publication | | Title: | Fundamental structural studies of metanaphthene and introduction of disulfide bonds | | Authors: | Liang, C. | | Deposition date: | 2025-07-06 |
|
| PDBID: | 9vr1 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of human phospholysine phosphohistidine inorganic pyrophosphate phosphatase LHPP | | Authors: | Xue, S.Y., Luo, C. | | Deposition date: | 2025-07-05 | | Release date: | 2026-07-05 |
|
| PDBID: | 9vq5 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Peroxiredoxin I in complex with SAC | | Authors: | Zhu, Y.Y., Xu, H., Zhang, H., Luo, C. | | Deposition date: | 2025-07-04 |
|
| PDBID: | 9vq3 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of human phosphodiesterase 10A in complex with (6-fluoro-2-(1-(4-methylquinazolin-2-yl)azetidin-3-yl)imidazo[1,2-a]pyridin-3-yl)(4,7-diazaspiro[2.5]octan-7-yl)methanone | | Authors: | Zhang, F.C., Huang, Y.Y., Luo, H.B., Guo, L. | | Deposition date: | 2025-07-04 |
|
| PDBID: | 9vq6 | | Status: | HPUB -- hold until publication | | Title: | Strcture of Nanobody (NB) specific to Interleukin-6 | | Authors: | Talwar, C.S., Ahn, W.C., Lee, S.J., Woo, E.J. | | Deposition date: | 2025-07-04 |
|
| PDBID: | 9vq7 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of human phospholysine phosphohistidine inorganic pyrophosphate phosphatase LHPP in complex with Ca | | Authors: | Xue, S.Y., Luo, C. | | Deposition date: | 2025-07-04 | | Release date: | 2026-07-04 |
|
| PDBID: | 9ruj | | Status: | HPUB -- hold until publication | | Title: | Streptococcus pneumoniae StkP catalytic domain T167E/T169E double mutant in complex with AMP-PNP and Mn2+ | | Authors: | Hamidi, M., Ravaud, S., Grangeasse, C. | | Deposition date: | 2025-07-04 |
|
| PDBID: | 9ruk | | Status: | HPUB -- hold until publication | | Title: | Streptococcus pneumoniae StkP catalytic domain T167A/T169A double mutant in complex with AMP-PNP and Mn2+ | | Authors: | Hamidi, M., Ravaud, S., Grangeasse, C. | | Deposition date: | 2025-07-04 |
|
| PDBID: | 9pf1 | | Status: | HPUB -- hold until publication | | Title: | Nub1/Fat10-processing human 26S proteasome with Rpt4 at top of spiral staircase (AAA+ motor locally refined) | | Authors: | Arkinson, C., Gee, C.L., Martin, A. | | Deposition date: | 2025-07-03 |
|
| PDBID: | 9vpp | | Status: | HOLD -- hold until a certain date | | Title: | Structural Basis for sBCMA Resistance and Antigen Escape in Eque-cel BCMA CAR-T Cell Therapy | | Authors: | Li, C. | | Deposition date: | 2025-07-03 | | Release date: | 2026-07-03 |
|
| PDBID: | 9ru3 | | Status: | HPUB -- hold until publication | | Title: | Streptococcus pneumoniae StkP catalytic domain T167A/T169A double mutant | | Authors: | Gueguen-Chaignon, V., Ravaud, S., Grangeasse, C. | | Deposition date: | 2025-07-03 |
|
| PDBID: | 9pew | | Status: | HPUB -- hold until publication | | Title: | Porcine ATP synthase with inhibitory protein IF1, DP-state | | Authors: | Mnatsakanyan, N., Mello, J.F.R., Palles, C. | | Deposition date: | 2025-07-02 |
|
| PDBID: | 9pex | | Status: | HPUB -- hold until publication | | Title: | Porcine ATP synthase with inhibitory protein IF1, F1 domain, E-state | | Authors: | Mnatsakanyan, N., Mello, J.F.R., Palles, C. | | Deposition date: | 2025-07-02 |
|
| PDBID: | 9pem | | Status: | HPUB -- hold until publication | | Title: | Porcine ATP synthase without inhibitory protein IF1, DP-state | | Authors: | Mnatsakanyan, M., Mello, J.F.R., Palles, C. | | Deposition date: | 2025-07-02 |
|
| PDBID: | 9rtb | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the adduct formed upon reaction of [V(IV)O(acetylacetonate)2] with human serum transferrin with Fe(III) bound at the C-lobe only | | Authors: | Paolillo, M., Ferraro, G., Banneville, A.S., Cornaciu, I., Pica, A., Merlino, A. | | Deposition date: | 2025-07-02 |
|
| PDBID: | 9rtf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the human serum transferrin with Fe(III) bound at the C-lobe only | | Authors: | Paolillo, M., Ferraro, G., Banneville, A.S., Cornaciu, I., Pica, A., Merlino, A. | | Deposition date: | 2025-07-02 |
|
| PDBID: | 9rth | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the human serum transferrin with Fe(III) bound at the C-lobe only (treated with DMSO) | | Authors: | Paolillo, M., Ferraro, G., Banneville, A.S., Cornaciu, I., Pica, A., Merlino, A. | | Deposition date: | 2025-07-02 |
|
| PDBID: | 9vnw | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Pyrococcus abyssi AIR synthetase with an N-terminal 54-residues deletion | | Authors: | Chen, Y.H., Chen, C.J. | | Deposition date: | 2025-07-01 |
|
| PDBID: | 9vnv | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Pyrococcus abyssi AIR synthetase with an N-terminal 43-residues deletion | | Authors: | Chen, Y.H., Chen, C.J. | | Deposition date: | 2025-07-01 |
|
