Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9rdf
Status:HPUB -- hold until publication
Title:Liver Pyruvate kinase in complex with a phthalazine-based fluorescent probe IV
Authors:Nilssson, O., Brear, P., Grotli, M., Hyvonen, M.
Deposition date:2025-06-02
PDBID:9v95
Status:AUTH -- processed, waiting for author review and approval
Title:Cryo-EM structure of the ArlB filament of Haloarcula marismortui
Authors:Meshcheryakov, V.A., Hyun, J., Syutkin, A.S., Pyatibratov, M.G., Wolf, M.
Deposition date:2025-05-30
PDBID:9v96
Status:AUTH -- processed, waiting for author review and approval
Title:Cryo-EM structure of the inner core of ArlA2 filament of Haloarcula marismortui
Authors:Meshcheryakov, V.A., Hyun, J., Syutkin, A.S., Pyatibratov, M.G., Wolf, M.
Deposition date:2025-05-30
PDBID:9v8v
Status:HPUB -- hold until publication
Title:Influenza A/H5N6 polymerase symmetric dimer in pre-initiation state bound vRNA promoter
Authors:Wang, A.J., Liao, M.
Deposition date:2025-05-30
PDBID:9v8z
Status:HPUB -- hold until publication
Title:Cryo-EM structure of renal amyloid fibril from an immunoglobulin light chain amyloidosis patient in polymorph A
Authors:Zhao, K., Yu, C.Y., Ma, Y.Y., Huang, H.
Deposition date:2025-05-30
PDBID:9ovh
Status:HPUB -- hold until publication
Title:Structure of an ancestral ethylene forming enzyme, Anc357, in complex with Mn
Authors:Chatterjee, S., Rankin, J.A., Farrugia, M.A., Hu, J., Hausinger, R.P.
Deposition date:2025-05-30
PDBID:9rcx
Status:HPUB -- hold until publication
Title:Structure of protein kinase CK2alpha mutant T127M associated with the Okur-Chung Neurodevelopmental Syndrome
Authors:Werner, C., Gast, A., Jose, J., Niefind, K.
Deposition date:2025-05-30
PDBID:9rcy
Status:HPUB -- hold until publication
Title:Structure of protein kinase CK2alpha mutant R21Q associated with the Okur-Chung Neurodevelopmental Syndrome
Authors:Werner, C., Gast, A., Jose, J., Niefind, K.
Deposition date:2025-05-30
PDBID:9rcw
Status:HPUB -- hold until publication
Title:Primed-state RyR1 in 0.01% POPC micelles, in complex with a nanobody and FKBP12
Authors:Li, C., Efremov, R.G.
Deposition date:2025-05-30
PDBID:9v8b
Status:AUTH -- processed, waiting for author review and approval
Title:Influenza A/H5N6 polymerase in initiation state with bound vRNA promoter
Authors:Wang, A.J., Liao, M.
Deposition date:2025-05-29
PDBID:9v8j
Status:HPUB -- hold until publication
Title:Influenza A polymerase in intermediate state with bound vRNA promoter
Authors:Wang, A.J., Liao, M.
Deposition date:2025-05-29
PDBID:9v8k
Status:HPUB -- hold until publication
Title:Influenza A polymerase in Pre-initiation state with bound vRNA promoter
Authors:Wang, A.J., Liao, M.
Deposition date:2025-05-29
PDBID:9v8o
Status:AUTH -- processed, waiting for author review and approval
Title:Influenza A/H5N6 polymerase symmetric dimer in termination state bound vRNA promoter
Authors:Wang, A.J., Liao, M.
Deposition date:2025-05-29
PDBID:9v83
Status:HOLD -- hold until a certain date
Title:Crystal Structure of Asparagine Synthetase from Entamoeba histolytica
Authors:Mishra, S., Yadav, L., Gautam, A.K., Gourinath, S.
Deposition date:2025-05-29
Release date:2026-05-29
PDBID:9ovf
Status:HPUB -- hold until publication
Title:Rubredoxin covalently linked to benzo-18-crown-6
Authors:Adhami, N., Sawaya, M.R., Shafaat, H.S., Rodriguez, J.A., Spokoyny, A.M.
Deposition date:2025-05-29
Sequence:

>Entity 1


MQKYVCNVCGYEYDPAEHDNVPFDQLPDDWCCPVCGVSKDQFSPA
PDBID:9ous
Status:AUTH -- processed, waiting for author review and approval
Title:D3 Virion icos
Authors:Belford, A.K., Huet, A., Maurer, J.B., Duda, R.L., Conway, J.F.
Deposition date:2025-05-29
PDBID:9ouq
Status:HPUB -- hold until publication
Title:Native GABA-A receptor from rat cerebella, beta1-alpha1-beta2-alpha1-gamma2 subtype, in complex with GABA
Authors:Sun, C., Gouaux, E.
Deposition date:2025-05-29
PDBID:9our
Status:HPUB -- hold until publication
Title:Native GABA-A receptor from rat cerebella, beta2-alpha1-beta2-alpha1-gamma2 subtype, in complex with GABA
Authors:Sun, C., Gouaux, E.
Deposition date:2025-05-29
PDBID:9oum
Status:HPUB -- hold until publication
Title:Native GABA-A receptor from rat cerebella, beta2-alpha1-beta1-alpha6-gamma2 subtype, in complex with GABA and PZ-II-029
Authors:Sun, C., Gouaux, E.
Deposition date:2025-05-29
PDBID:9ouo
Status:HPUB -- hold until publication
Title:Native GABA-A receptor from rat cerebella, beta1-alpha1-beta1-alpha1-gamma2 subtype, in complex with GABA and PZ-II-029
Authors:Sun, C., Gouaux, E.
Deposition date:2025-05-29
PDBID:9ov4
Status:HPUB -- hold until publication
Title:Native GABA-A receptor from rat cerebella, beta1-alpha1-beta2-alpha1-gamma2 subtype, in complex with GABA and PZ-II-029
Authors:Sun, C., Gouaux, E.
Deposition date:2025-05-29
PDBID:9ouz
Status:HPUB -- hold until publication
Title:Icosahedral D3 expanded capsid
Authors:Belford, A.K., Huet, A., Maurer, J.B., Duda, R.L., Conway, J.F.
Deposition date:2025-05-29
PDBID:9oun
Status:HPUB -- hold until publication
Title:Native GABA-A receptor from rat cerebella, beta2-alpha1-beta2-alpha1-gamma2 subtype, in complex with GABA and PZ-II-029
Authors:Sun, C., Gouaux, E.
Deposition date:2025-05-29
PDBID:9oup
Status:HPUB -- hold until publication
Title:Native GABA-A receptor from rat cerebella, beta2-alpha1-beta1-alpha6-gamma2 subtype, in complex with GABA
Authors:Sun, C., Gouaux, E.
Deposition date:2025-05-29
PDBID:9v7k
Status:HPUB -- hold until publication
Title:Phycobilisome allophycocyanin hexamer C from Gloeobacter violaceus PCC 7421
Authors:Burtseva, A.D., Baymukhametov, T.N., Slonimskiy, Y.B., Popov, V.O., Sluchanko, N.N., Boyko, K.M.
Deposition date:2025-05-28

238582

數據於2025-07-09公開中

PDB statisticsPDBj update infoContact PDBjnumon