| PDBID: | 9z5t | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the transpeptidase domain of PBP2 from the Neisseria gonorrhoeae cephalosporin-resistant strain H041 in complex with boronate inhibitor VNRX-14079 | | Authors: | Bala, S., Stratton, C.M., Davies, C. | | Deposition date: | 2025-11-12 |
|
| PDBID: | 9xmr | | Status: | PROC -- to be processed | | Title: | the structure of HLA*1101 complex with peptide from H1N1 NP342-351 RVSSFIRGKK | | Authors: | Liu, C.Y., Guo, P.P., Liu, J. | | Deposition date: | 2025-11-11 |
|
| PDBID: | 9z55 | | Status: | PROC -- to be processed | | Title: | Isoreticular co-crystal 1 with asymmetrical expanded duplex (31mer) containing insert sequence CATGAGTCAT | | Authors: | Shields, E.T., Slaughter, C.K., Magna, E.N., Snow, C.D. | | Deposition date: | 2025-11-11 |
|
| PDBID: | 9xme | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Complex of HLA-A2, a class I MHC, with a wild type UTP20 peptide | | Authors: | Wang, J., Wu, D.C. | | Deposition date: | 2025-11-10 |
|
| PDBID: | 9xmg | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of ATTRA97S amyloid fibrils extracted from patient-derived abdominal adipose biopsy tissue (patient 2). | | Authors: | Ma, B.Y., Yao, Y.X., Li, D., Liu, C. | | Deposition date: | 2025-11-10 |
|
| PDBID: | 9xmi | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of ATTRA97S amyloid fibrils extracted from patient-derived abdominal adipose biopsy tissue (patient 3). | | Authors: | Ma, B.Y., Yao, Y.X., Li, D., Liu, C. | | Deposition date: | 2025-11-10 |
|
| PDBID: | 9t7k | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the N-terminal domain of PilB from Myxococcus xanthus | | Authors: | Herrou, C., Bornet, O., Mignot, T., Mercier, R., Elantak, L. | | Deposition date: | 2025-11-10 |
|
| PDBID: | 9z4m | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | 80S ribosome bound to SW394970 inhibitor | | Authors: | Cruz, V.E., Morgenstern, C.C., Ready, J.M., Erzberger, J.P. | | Deposition date: | 2025-11-10 |
|
| PDBID: | 9z4e | | Status: | PROC -- to be processed | | Title: | Isoreticular co-crystal 1 with asymmetrical expanded duplex (31mer) containing insert sequence CATGAGTCAT and loaded with mutated Bzip region of GCN4 transcription factor | | Authors: | Shields, E.T., Slaughter, C.K., Magna, E.N., Snow, C.D. | | Deposition date: | 2025-11-10 |
|
| PDBID: | 9z4g | | Status: | HPUB -- hold until publication | | Title: | Structure of the N-terminal N1 Domain of S. mutans WapA | | Authors: | Schormann, N., Deivanayagam, C. | | Deposition date: | 2025-11-10 | | Sequence: | >Entity 1
MGDQVTNYTNTASITKSDGTALSNDPSKAVNYWEPLSFSNSITFPDEVSIKAGDTLTIKLPEQLQFTTALTFDVMHTNGQLAGKATTDPNTGEVTVTFTDIFEKLPNDKAMTLNFNAQLNHNNISIPGVVNFNYNNVAYSSYVKDKDITPISPLEHHHHHH
|
|
| PDBID: | 9z49 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the human PRMT5:MEP50:pICln complex at a 4:4:4 stoichiometric ratio | | Authors: | Xu, X., Chi, Z., Jiang, W., Li, C. | | Deposition date: | 2025-11-09 |
|
| PDBID: | 9z4a | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the human PRMT5:MEP50:pICln complex at a 4:3:4 stoichiometric ratio | | Authors: | Xu, X., Chi, Z., Jiang, W., Li, C. | | Deposition date: | 2025-11-09 |
|
| PDBID: | 9z43 | | Status: | PROC -- to be processed | | Title: | Isoreticular co-crystal 1 of protein variant Replication initiator protein RepE54 fused to Engrailed Homeodomain with asymmetrical expanded duplex (31mer) containing insert sequence CTAATTAGGC | | Authors: | Shields, E.T., Snow, C.D. | | Deposition date: | 2025-11-08 |
|
| PDBID: | 9z41 | | Status: | PROC -- to be processed | | Title: | Isoreticular co-crystal 1 with asymmetrical expanded duplex (31mer) containing insert sequence CCAAGCGCAA and inter-protein disulfide bond | | Authors: | Shields, E.T., Slaughter, C.K., Magna, E.N., Snow, C.D. | | Deposition date: | 2025-11-08 |
|
| PDBID: | 9z42 | | Status: | PROC -- to be processed | | Title: | Isoreticular co-crystal 1 with N-terminal Spytag fusion and symmetrical expanded duplex (31mer) containing insert sequence CCCGGCCGGA | | Authors: | Shields, E.T., Slaughter, C.K., Magna, E.N., Snow, C.D. | | Deposition date: | 2025-11-08 |
|
| PDBID: | 9z44 | | Status: | PROC -- to be processed | | Title: | Isoreticular co-crystal 1 with symmetrical expanded duplex (31mer) containing insert sequence CCCGGCCGGA and loaded with C-clamp domain | | Authors: | Shields, E.T., Slaughter, C.K., Magna, E.N., Snow, C.D. | | Deposition date: | 2025-11-08 |
|
| PDBID: | 9xl9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of in vitro ANXA11 (residue 1-80) fibril | | Authors: | Li, M.R.J., Liu, C. | | Deposition date: | 2025-11-07 | | Release date: | 2026-11-07 |
|
| PDBID: | 9t6k | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of wild-type c-MET bound by glumetinib. | | Authors: | Collie, G.W., van Beek, L. | | Deposition date: | 2025-11-07 |
|
| PDBID: | 9xkv | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The cryo-EM structure of apo Tau PHF fibril | | Authors: | Zhao, Q.Y., Cao, T.Y., Liu, C., Li, D. | | Deposition date: | 2025-11-06 |
|
| PDBID: | 9t61 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Doxycycline Bound C. burnetii 30S Ribosome | | Authors: | Stuart, W.S., Isupov, M.N., Harmer, N.J. | | Deposition date: | 2025-11-06 |
|
| PDBID: | 9t5x | | Status: | PROC -- to be processed | | Title: | Structure of a stalled E. coli 70S RNC-NuoK-70 in complex with the membrane protein insertase SecYEG-YidC | | Authors: | Rosales-Hernandez, C., Busch, M., Kamel, M., Beckmann, R., Kedrov, A. | | Deposition date: | 2025-11-06 |
|
| PDBID: | 9xjo | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human Keratin 19 tail domain with phospho-tyrosine (phosphorylated Y391) Q387-L400 in solution | | Authors: | Ji, Y., Jeong, M., Kim, J., Lee, C.H. | | Deposition date: | 2025-11-05 |
|
| PDBID: | 9xjr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The Curved structure of mPIEZO1-R2482H in Lipid Bilaye | | Authors: | Wang, C., Zhang, Z., Yang, X., Liu, S., Li, X., Xiao, B. | | Deposition date: | 2025-11-05 |
|
| PDBID: | 9xjs | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The Flattened Structure of mPIEZO1-R2482H in Lipid Bilayer | | Authors: | Wang, C., Zhang, Z., Yang, X., Liu, S., Li, X., Xiao, B. | | Deposition date: | 2025-11-05 |
|
| PDBID: | 9t5g | | Status: | PROC -- to be processed | | Title: | Structure of a stalled E. coli 70S RNC-NuoK-86 in complex with the SecYEG translocon | | Authors: | Rosales-Hernandez, C., Busch, M., Kamel, M., Kedrov, A., Beckmann, R. | | Deposition date: | 2025-11-05 |
|
