| PDBID: | 9uwb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Pictet-Spenglerase AsKslB and the compound AsKslB with L-Trp | | Authors: | Qiao, Z., Yang, X.N., Teng, Y.B. | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9uwc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Pictet-Spenglerase AsKslB and the compound AsKslB with iminium ion intermediate | | Authors: | Qiao, Z., Yang, X.N., Teng, Y.B. | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9uwr | | Status: | HPUB -- hold until publication | | Title: | Pictet-Spenglerase AsKslB in complex with product of L-Trp and a-ketoglutaric acid | | Authors: | Qiao, Z., Yang, X.N., Teng, Y.B. | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9r6j | | Status: | HPUB -- hold until publication | | Title: | Map of neurofibromin homotetramer with D2 symmetry (DeepEMhancer) | | Authors: | Shutian, S. | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9uti | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Tetrahymena Ribozyme L-16 complex with small molecule inhibitor ZPT-01 | | Authors: | Pan, Z.L., Ma, H.Y., Su, Z.M. | | Deposition date: | 2025-05-04 | | Release date: | 2026-05-04 |
|
| PDBID: | 9r21 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the flotillin-associated rhodopsin PsFAR in detergent micelle | | Authors: | Kovalev, K., Stetsenko, A., Marin, E., Guskov, A. | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9r22 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the light-driven proton pump PsPR in detergent micelle | | Authors: | Kovalev, K., Stetsenko, A., Guskov, A. | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9r23 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the double mutant H84V/E120G of the flotillin-associated rhodopsin PsFAR in detergent micelle | | Authors: | Kovalev, K., Stetsenko, A., Guskov, A. | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9uja | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of SME-1 E166A with cefotetan | | Authors: | Dhankhar, K., Hazra, S. | | Deposition date: | 2025-04-17 |
|
| PDBID: | 9o84 | | Status: | HPUB -- hold until publication | | Title: | Structure of turkey hemoglobin A at 1.7 Angstrom resolution (tetragonal form) | | Authors: | Bingman, C.A., Yin, J., Smith, R.W., Richards, M.P. | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9qwd | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of furin (PCSK3) in complex with the biphenyl-derived compound mi2470 | | Authors: | Dahms, S.O., Brandstetter, H. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9qw0 | | Status: | HPUB -- hold until publication | | Title: | Nostoc sp. 3335mg GT108 family enzyme D90A mutant complex with octyl-mannotetraose and Bis-Tris | | Authors: | Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J. | | Deposition date: | 2025-04-13 |
|
| PDBID: | 9qw1 | | Status: | HPUB -- hold until publication | | Title: | Nostoc sp. 3335mg GT108 family enzyme D90A mutant complex with octyl-mannotetraose | | Authors: | Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J. | | Deposition date: | 2025-04-13 |
|
| PDBID: | 9o5g | | Status: | HPUB -- hold until publication | | Title: | Room-temperature joint X-ray/Neutron structure of Thermus thermophilus SHMT in complex with PLP-Gly external aldimine and 5-methyl-tetrahydrofolate (5MTHF) | | Authors: | Kovalevsky, A., Drago, V.N., Phillips, R.S. | | Deposition date: | 2025-04-10 | | Sequence: | >Entity 1
STLKRDEALFELIALEEKRQREGLELIASENFVSKQVREAVGSVLTNKYAEGYPGARYYGGCEVIDRVESLAIERAKALFGAAWANVQPHSGSQANMAVYMALMEPGDTLMGMDLAAGGHLTHGSRVNFSGKLYKVVSYGVRPDTELIDLEEVRRLALEHRPKVIVAGASAYPRFWDFKAFREIADEVGAYLVVDMAHFAGLVAAGLHPNPLPYAHVVTSTTHKTLRGPRGGLILSNDPELGKRIDKLIFPGIQGGPLEHVIAGKAVAFFEALQPEFKEYSRLVVENAKRLAEELARRGYRIVTGGTDNHLFLVDLRPKGLTGKEAEERLDAVGITVNKNAIPFDPKPPRVTSGIRIGTPAITTRGFTPEEMPLVAELIDRALLEGPSEALREEVRRLALAHPMP
|
|
| PDBID: | 9qu9 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Arabidopsis TIR-NLR WRR4A tetramer in complex with effector CCG40 (C2-symmetry) | | Authors: | Zhao, H., Lukoyanova, N., Selvaraj, M., Jones, J. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9o50 | | Status: | HPUB -- hold until publication | | Title: | Room-temperature X-ray structure of Thermus thermophilus SHMT in complex with tetrahydrofolate (THF) | | Authors: | Kovalevsky, A., Drago, V.N., Phillips, R.S. | | Deposition date: | 2025-04-09 | | Sequence: | >Entity 1
STLKRDEALFELIALEEKRQREGLELIASENFVSKQVREAVGSVLTNKYAEGYPGARYYGGCEVIDRVESLAIERAKALFGAAWANVQPHSGSQANMAVYMALMEPGDTLMGMDLAAGGHLTHGSRVNFSGKLYKVVSYGVRPDTELIDLEEVRRLALEHRPKVIVAGASAYPRFWDFKAFREIADEVGAYLVVDMAHFAGLVAAGLHPNPLPYAHVVTSTTH(LLP)TLRGPRGGLILSNDPELGKRIDKLIFPGIQGGPLEHVIAGKAVAFFEALQPEFKEYSRLVVENAKRLAEELARRGYRIVTGGTDNHLFLVDLRPKGLTGKEAEERLDAVGITVNKNAIPFDPKPPRVTSGIRIGTPAITTRGFTPEEMPLVAELIDRALLEGPSEALREEVRRLALAHPMP
|
|
| PDBID: | 9qt4 | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of Arabidopsis TIR-NLR WRR4A tetramer in complex with effector CCG40 (focused refinement) | | Authors: | Zhao, H., Lukoyanova, N., Selvaraj, M., Jones, J. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9qsn | | Status: | HPUB -- hold until publication | | Title: | Tetrapodal ancestor of L-amino acid oxidases co-crystallized with indole-3-acetic acid | | Authors: | Massari, M., Mattevi, A. | | Deposition date: | 2025-04-06 |
|
| PDBID: | 9qso | | Status: | HPUB -- hold until publication | | Title: | Tetrapodal ancestor of L-amino acid oxidases co-crystallised with indole-3-pyruvate | | Authors: | Massari, M., Mattevi, A. | | Deposition date: | 2025-04-06 |
|
| PDBID: | 9qrt | | Status: | HPUB -- hold until publication | | Title: | FSP1 (tetrapod ancestor; L323A mutant) bound to FAD and NAD+ and compound 2 | | Authors: | Cecchini, D., Mattevi, A. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9qs1 | | Status: | HPUB -- hold until publication | | Title: | Tetrapodal ancestor of L-amino acid oxidases | | Authors: | Massari, M., Mattevi, A. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9qr6 | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of the tetrahedral M42 aminopeptidase from M. jannaschii | | Authors: | Atalah, J., Basbous, H., Girard, E., Effantin, E., Schoehn, G., Franzetti, B. | | Deposition date: | 2025-04-03 |
|
| PDBID: | 9nzm | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Kirsten Rat Sarcoma G12C Complexed with GMPPNP and Covalently Bound to an Adduct of {(2S)-4-[7-(8-chloronaphthalen-1-yl)-2-{[(2S)-1-methylpyrrolidin-2-yl]methoxy}-5,6,7,8-tetrahydropyrido[3,4-d]pyrimidin-4-yl]-1-[(2Z)-2-fluoro-3-(pyridin-2-yl)prop-2-enoyl]piperazin-2-yl}acetonitrile | | Authors: | Sheriff, S., Pokross, M., Witmer, M. | | Deposition date: | 2025-04-01 |
|
| PDBID: | 9nzn | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Kirsten Rat Sarcoma G12C Complexed with GDP and Covalently Bound to an Adduct of (2S)-1-{4-[(7P)-7-(8-ethynyl-7-fluoro-3-hydroxynaphthalen-1-yl)-8-fluoro-2-{[(2R,4R,7aS)-2-fluorotetrahydro-1H-pyrrolizin-7a(5H)-yl]methoxy}pyrido[4,3-d]pyrimidin-4-yl]piperazin-1-yl}-2-fluoro-3-(1,3-thiazol-2-yl)propan-1-one | | Authors: | Sheriff, S., Pokross, M., Witmer, M. | | Deposition date: | 2025-04-01 |
|
| PDBID: | 9nyf | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the glycosyltransferase GtrB (tetramer volume) | | Authors: | Morgan, R.T., Motta, S., Gil-Iturbe, E., di Muccio, G., Bhattacharjee, B., Romagnoli, A., Anwar, M.T., Mishra, B., Ashraf, K., Bang, I., di Marino, D., Lowary, T.L., Quick, M., Petrou, V.I., Stowell, M.H.B., Nygaard, R., Mancia, F. | | Deposition date: | 2025-03-27 |
|
