| PDBID: | 9ypz | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Vacant ribosome with P-site tRNA, substate 1, Structure Ia | | Authors: | Susorov, D., Korostelev, A.A. | | Deposition date: | 2025-10-14 |
|
| PDBID: | 9yq0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Vacant ribosome with P-site tRNA, substate 2, Structure Ib | | Authors: | Susorov, D., Korostelev, A.A. | | Deposition date: | 2025-10-14 |
|
| PDBID: | 9yq1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Vacant ribosome with P-site tRNA, substate 3, Structure Ic | | Authors: | Susorov, D., Korostelev, A.A. | | Deposition date: | 2025-10-14 |
|
| PDBID: | 9yp3 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the 26 kDa glutathione transferase from Taenia solium in the presence of the compound mebendazole | | Authors: | Hernandez-Santoyo, A., Rodriguez-Romero, A., Ramirez-Rodriguez, M.A. | | Deposition date: | 2025-10-13 |
|
| PDBID: | 9syd | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Beyond single-state RNA structural biology: MD/NMR description of temperature-sensitive dynamic RNA ensembles - GCAA ARIA 1+3 motif | | Authors: | Leopold, D., Oxenfarth, A., Thomasen, F.E., Kuemmerer, F., Schnieders, R., Pinter, G., Wacker, A., Jonker, H.R.A., Fuertig, B., Richter, C., Lindorff-Larson, K., Schwalbe, H. | | Deposition date: | 2025-10-11 |
|
| PDBID: | 9syc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Beyond single-state RNA structural biology: MD/NMR description of temperature-sensitive dynamic RNA ensembles - GAAG reweighted MD subensemble | | Authors: | Leopold, D., Oxenfarth, A., Thomasen, F.E., Kuemmerer, F., Schnieders, R., Pinter, G., Wacker, A., Jonker, H.R.A., Fuertig, B., Richter, C., Lindorff-Larson, K., Schwalbe, H. | | Deposition date: | 2025-10-11 |
|
| PDBID: | 9syf | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Beyond single-state RNA structural biology: MD/NMR description of temperature-sensitive dynamic RNA ensembles - GCAA MD conformational ensemble | | Authors: | Leopold, D., Oxenfarth, A., Thomasen, F.E., Kuemmerer, F., Schnieders, R., Pinter, G., Wacker, A., Jonker, H.R.A., Fuertig, B., Richter, C., Lindorff-Larson, K., Schwalbe, H. | | Deposition date: | 2025-10-11 |
|
| PDBID: | 9sye | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Beyond single-state RNA structural biology: MD/NMR description of temperature-sensitive dynamic RNA ensembles - GCAA ARIA 2+2 motif | | Authors: | Leopold, D., Oxenfarth, A., Thomasen, F.E., Kuemmerer, F., Schnieders, R., Pinter, G., Wacker, A., Jonker, H.R.A., Fuertig, B., Richter, C., Lindorff-Larson, K., Schwalbe, H. | | Deposition date: | 2025-10-11 |
|
| PDBID: | 9sy8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Beyond single-state RNA structural biology: MD/NMR description of temperature-sensitive dynamic RNA ensembles - GAAG ARIA structure | | Authors: | Leopold, D., Oxenfarth, A., Thomasen, F.E., Kuemmerer, F., Schnieders, R., Pinter, G., Wacker, A., Jonker, H.R.A., Fuertig, B., Richter, C., Lindorff-Larson, K., Schwalbe, H. | | Deposition date: | 2025-10-10 |
|
| PDBID: | 9sxv | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | NMR structure determination of a dynamic and thermodynamically stable CUUG RNA tetraloop | | Authors: | Oxenfarth, A., Kuemmerer, F., Leopold, D., Bottaro, S., Schnieders, R., Pinter, G., Jonker, H.R.A., Fuertig, B., Richter, C., Blackledge, M., Lindorff-Larsen, K., Schwalbe, H. | | Deposition date: | 2025-10-10 |
|
| PDBID: | 9sy4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | NMR structure determination of a dynamic and thermodynamically stable CUUG RNA tetraloop without restrained loop base pair | | Authors: | Oxenfarth, A., Kuemmerer, F., Leopold, D., Bottaro, S., Schnieders, R., Pinter, G., Jonker, H.R.A., Fuertig, B., Richter, C., Blackledge, M., Lindorff-Larsen, K., Schwalbe, H. | | Deposition date: | 2025-10-10 |
|
| PDBID: | 9x2t | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Cas12i3 with crRNA and Target DNA | | Authors: | Xi, Z. | | Deposition date: | 2025-10-08 |
|
| PDBID: | 9x37 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Cas12i3 with crRNA and Target DNA, conformation 1 | | Authors: | Zhang, X. | | Deposition date: | 2025-10-08 |
|
| PDBID: | 9x3a | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Cas-SF01 (Cas12i3-S7R/D233R/D267R/N369R/S433R) with crRNA and Target DNA, conformation 2 | | Authors: | Xi, Z. | | Deposition date: | 2025-10-08 |
|
| PDBID: | 9x3b | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Cas-SF01 (Cas12i3-S7R/D233R/D267R/N369R/S433R) with crRNA and Target DNA, conformation 1 | | Authors: | Zhang, X. | | Deposition date: | 2025-10-08 |
|
| PDBID: | 9swz | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Structure of MM762(D10A)-sgRNA/DNA ternary complex | | Authors: | Ekundayo, B.E., Ni, D.C., Stahlberg, H. | | Deposition date: | 2025-10-08 |
|
| PDBID: | 9sx0 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Structure of eMM762v1-sgRNA/DNA ternary complex | | Authors: | Ekundayo, B.E., Ni, D.C., Stahlberg, H. | | Deposition date: | 2025-10-08 |
|
| PDBID: | 9yk1 | | Status: | HPUB -- hold until publication | | Title: | Room-temperature X-ray structure of D132N Bacillus halodurans RNase H1 in complex with RNA/DNA duplex | | Authors: | Kovalevsky, A., Gerlits, O. | | Deposition date: | 2025-10-06 | | Sequence: | >Entity 1
SAKEEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYGRK
>Entity 2
UCGACA
>Entity 3
(DA)(DT)(DG)(DT)(DC)(DG)
|
|
| PDBID: | 9yk3 | | Status: | HPUB -- hold until publication | | Title: | Room-temperature X-ray structure of D132N Bacillus halodurans RNase H1 in complex with complementary RNA/DNA duplex | | Authors: | Kovalevsky, A., Gerlits, O. | | Deposition date: | 2025-10-06 | | Sequence: | >Entity 1
SAKEEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYGRK
>Entity 2
CGACAU
>Entity 3
(DA)(DT)(DG)(DT)(DC)(DG)
|
|
| PDBID: | 9yk5 | | Status: | HPUB -- hold until publication | | Title: | 100K X-ray structure of mixed metal D132N Bacillus halodurans RNase H1 complex with RNA/DNA duplex | | Authors: | Kovalevsky, A., Gerlits, O. | | Deposition date: | 2025-10-06 | | Sequence: | >Entity 1
SAKEEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYGRK
>Entity 2
UCGACA
>Entity 3
(DA)(DT)(DG)(DT)(DC)(DG)
|
|
| PDBID: | 9x28 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Borna disease virus RNA polymerase L protein | | Authors: | Ma, J., Yang, K., Wu, H., Liang, Z. | | Deposition date: | 2025-10-04 |
|
| PDBID: | 9x1v | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Borna disease virus RNA polymerase complex | | Authors: | Ma, J., Yang, K., Wu, H., Liang, Z. | | Deposition date: | 2025-10-03 |
|
| PDBID: | 9x21 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Tetrahymena Ribozyme scaffolded SicX sRNA in complex with C-di-GMP | | Authors: | Wang, C.C. | | Deposition date: | 2025-10-03 |
|
| PDBID: | 9yjl | | Status: | HPUB -- hold until publication | | Title: | Joint X-ray/neutron structure of wild-type Bacillus halodurans RNase H1 in the apo-form | | Authors: | Kovalevsky, A., Gerlits, O. | | Deposition date: | 2025-10-03 | | Sequence: | >Entity 1
SAKEEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSDSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYGRK
|
|
| PDBID: | 9yjm | | Status: | HPUB -- hold until publication | | Title: | Joint X-ray/neutron structure of D132N Bacillus halodurans RNase H1 in the apo-form | | Authors: | Kovalevsky, A., Gerlits, O. | | Deposition date: | 2025-10-03 | | Sequence: | >Entity 1
SAKEEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYGRK
|
|
