| PDBID: | 9v8n | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human glutaminyl-peptide cyclotransferase with I321V mutation, in complex with (E)-3-(2-methoxyphenyl)-6-((5-(prop-1-en-1-yl)-1H-imidazol-1-yl)methyl)pyridin-2(1H)-one | | Authors: | Li, G.B., Ning, X.-L. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9v8m | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human glutaminyl-peptide cyclotransferase in complex with 3-phenyl-6-((5-propyl-1H-imidazol-1-yl)methyl)pyridin-2(1H)-one | | Authors: | Li, G.B., Ning, X.-L. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9ouc | | Status: | HPUB -- hold until publication | | Title: | Influenza A Virus Nucleoprotein(8-498)NP complex with 5-(4-(morpholinomethyl)phenyl)-2-oxo-6-(trifluoromethyl)-1,2-dihydropyridine-3-carboxamide (Compound 3) | | Authors: | Mamo, M. | | Deposition date: | 2025-05-28 |
|
| PDBID: | 9oug | | Status: | HPUB -- hold until publication | | Title: | Influenza A Virus Nucleoprotein(8-498)NP complex with rac-5-(4-(((2R,6R)-6-(methoxymethyl)-6-methyl-1,4-dioxan-2-yl)methoxy)phenyl)-2-oxo-6-(trifluoromethyl)-1,2-dihydropyridine-3-carboxamide (Compound 20) | | Authors: | Mamo, M. | | Deposition date: | 2025-05-28 |
|
| PDBID: | 9v6b | | Status: | HPUB -- hold until publication | | Title: | Neutron crystal structure of the oxidized form of b5R at pD 6.5 | | Authors: | Hirano, Y., Kurihara, K., Kusaka, K., Ostermann, A., Hikita, M., Kimura, S., Miki, K., Tamada, T. | | Deposition date: | 2025-05-27 |
|
| PDBID: | 9v6c | | Status: | HPUB -- hold until publication | | Title: | Neutron crystal structure of the oxidized form of b5R at pD 7.5 | | Authors: | Hirano, Y., Kurihara, K., Kusaka, K., Ostermann, A., Hikita, M., Kimura, S., Miki, K., Tamada, T. | | Deposition date: | 2025-05-27 |
|
| PDBID: | 9otu | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Salmonella FraB Deglycase, E214A Mutant, Crystal Form 5 | | Authors: | Bell, C.E., Zakharova, K. | | Deposition date: | 2025-05-27 | | Sequence: | >Entity 1
MDHHHHHHENLYFQMEPEESMMGMKETVSNIVTSQAEKGGVKHVYYVACGGSYAAFYPAKAFLEKEAKALTVGLYNSGEFINNPPVALGENAVVVVASHKGNTPETIKAAEIARQHGAPVIGLTWIMDSPLVAHCDYVETYTFGDGKDIAGEKTMKGLLSAVELLQQTEGYAHYDDFQDGVSKINRIVWRACEQVAERAQAFAQEYKDDKVIYTVASGAGYGAAYLQSICIFMAMQWIHSACIHSGEFFHGPFEITDANTPFFFQFSEGNTRAVDERALNFLKKYGRRIEVVDAAALGLSTIKTTVIDYFNHSLFNNVYPVYNRALAEARQHPLTTRRYMWKVEY
|
|
| PDBID: | 9v3s | | Status: | HPUB -- hold until publication | | Title: | Nav1.5 in complex with quinidine-azo | | Authors: | Huang, Z., Li, Z., Liu, S. | | Deposition date: | 2025-05-22 |
|
| PDBID: | 9v3d | | Status: | HPUB -- hold until publication | | Title: | SFX structure of 3-5 micrometers Lysozyme microcrystals | | Authors: | Luo, F., Kang, J., Tono, K., Iwata, S., Nango, E. | | Deposition date: | 2025-05-21 |
|
| PDBID: | 9v3h | | Status: | HPUB -- hold until publication | | Title: | Time-Resolved mixing crystallography structure of 3-5 micrometers Lysozyme microcrystals with 226 mM N-Acetyl-D-glucosamine at 2 seconds delay | | Authors: | Luo, F., Kang, J., Tono, K., Iwata, S., Nango, E. | | Deposition date: | 2025-05-21 |
|
| PDBID: | 9v3i | | Status: | HPUB -- hold until publication | | Title: | Time-Resolved mixing crystallography structure of 3-5 micrometers Lysozyme microcrystals with 226 mM N-Acetyl-D-glucosamine at 5 seconds delay | | Authors: | Luo, F., Kang, J., Tono, K., Iwata, S., Nango, E. | | Deposition date: | 2025-05-21 |
|
| PDBID: | 9v3j | | Status: | HPUB -- hold until publication | | Title: | Time-Resolved mixing crystallography structure of 3-5 micrometers Lysozyme microcrystals with 226 mM N-Acetyl-D-glucosamine at 9.7 seconds delay | | Authors: | Luo, F., Kang, J., Tono, K., Iwata, S., Nango, E. | | Deposition date: | 2025-05-21 |
|
| PDBID: | 9v3l | | Status: | HPUB -- hold until publication | | Title: | Time-Resolved mixing crystallography structure of 1 micrometer Lysozyme microcrystals with 226 mM N-Acetyl-D-glucosamine at 5.0 seconds delay | | Authors: | Luo, F., Kang, J., Tono, K., Iwata, S., Nango, E. | | Deposition date: | 2025-05-21 |
|
| PDBID: | 9v3m | | Status: | HPUB -- hold until publication | | Title: | Time-Resolved mixing crystallography structure of 1 micrometer Lysozyme microcrystals with 226 mM N-Acetyl-D-glucosamine at 7.5 seconds delay | | Authors: | Luo, F., Kang, J., Tono, K., Iwata, S., Nango, E. | | Deposition date: | 2025-05-21 |
|
| PDBID: | 9v3p | | Status: | HPUB -- hold until publication | | Title: | Time-Resolved mixing crystallography structure of 1 micrometer Lysozyme microcrystals with 452 mM N-Acetyl-D-glucosamine at 2.5 seconds delay | | Authors: | Luo, F., Kang, J., Tono, K., Iwata, S., Nango, E. | | Deposition date: | 2025-05-21 |
|
| PDBID: | 9v3r | | Status: | HPUB -- hold until publication | | Title: | Time-Resolved mixing crystallography structure of 1 micrometer Lysozyme microcrystals with 452 mM N-Acetyl-D-glucosamine at 5.0 seconds delay | | Authors: | Luo, F., Kang, J., Tono, K., Iwata, S., Nango, E. | | Deposition date: | 2025-05-21 |
|
| PDBID: | 9r9q | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | [FeFe]-hydrogenase from Nitratidesulfovibrio vulgaris str. Hildenborough at pH 5.04 | | Authors: | Bikbaev, K., Span, I. | | Deposition date: | 2025-05-20 | | Release date: | 2026-05-20 |
|
| PDBID: | 9r9r | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | [FeFe]-hydrogenase from Nitratidesulfovibrio vulgaris str. Hildenborough at pH 5.21 | | Authors: | Bikbaev, K., Span, I. | | Deposition date: | 2025-05-20 | | Release date: | 2026-05-20 |
|
| PDBID: | 9r9s | | Status: | HOLD -- hold until a certain date | | Title: | [FeFe]-hydrogenase from Nitratidesulfovibrio vulgaris str. Hildenborough at pH 5.45 | | Authors: | Bikbaev, K., Span, I. | | Deposition date: | 2025-05-20 | | Release date: | 2026-05-20 |
|
| PDBID: | 9v1q | | Status: | HPUB -- hold until publication | | Title: | CTP synthase RXN-state 5 | | Authors: | Guo, C.J. | | Deposition date: | 2025-05-19 |
|
| PDBID: | 9v2f | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | CTP synthase dDON-state 5 | | Authors: | Guo, C.J. | | Deposition date: | 2025-05-19 |
|
| PDBID: | 9onu | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of a P-loop mutant PTP-like myo-inositol phosphatase from Selenomonas ruminantium in complex with myo-inositol-(1,2,4,5,6)-pentakisphosphate | | Authors: | Cleland, C.P., Mosimann, S.C. | | Deposition date: | 2025-05-15 | | Release date: | 2025-11-15 |
|
| PDBID: | 9ooi | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of dihydrofolate reductase (DHFR) from the filarial nematode W. bancrofti in complex with NADPH and antifolate 2-({4-[(2-amino-4-oxo-4,7-dihydro-1H-pyrrolo[2,3-d]pyrimidin-5-yl)methyl]benzene-1-carbonyl}amino)benzoic acid (OG7 or TSD001) | | Authors: | Frey, K.M., Goodey, N.M., Kwarteng, S. | | Deposition date: | 2025-05-15 |
|
| PDBID: | 9r7w | | Status: | HPUB -- hold until publication | | Title: | 5-Helix Tile - Twist Corrected (5HT-TC) with 2''-Fluoro-modified pyrimidines (FY RNA) | | Authors: | Kristoffersen, E.L., Andersen, E.S., Zwergius, N.H. | | Deposition date: | 2025-05-15 |
|
| PDBID: | 9r79 | | Status: | HPUB -- hold until publication | | Title: | Imine Reductase IR91 from Kribbella flavida with NADP+ and 5-methoxy-2-tetralone | | Authors: | Srinivas, K., Gilio, A.K., Grogan, G. | | Deposition date: | 2025-05-14 |
|
