Loading
PDBj
MenuPDBj@FacebookPDBj@TwitterPDBj@YouTubewwPDB FoundationwwPDB
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:8yue
Status:HPUB -- hold until publication
Title:Crystal structure of the kinesin-14 motor protein from Drosophila melanogaster
Authors:Wei, Y., Jobichen, C., Imasaki, T., Nitta, R., Wang, M.Y., Sivaraman, J., Endow, S.A.
Deposition date:2024-03-27
PDBID:9esz
Status:HPUB -- hold until publication
Title:CDK2-cyclin A in complex with FragLite 14
Authors:Hope, I., Martin, M.P., Waring, M.J., Noble, M.E.M., Endicott, J.A., Tatum, N.J.
Deposition date:2024-03-26
Sequence:

>Entity 1


GPGSMENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTY(TPO)HEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL

>Entity 2


GVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQSWPESLVQKTGYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKNSKYHGVSLLNPPETLNVHHHHHH
PDBID:8s42
Status:HPUB -- hold until publication
Title:Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 80 (1124898)
Authors:Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R.
Deposition date:2024-02-21
PDBID:8rs1
Status:HPUB -- hold until publication
Title:CTX-M-14 measured via serial crystallography from a kapton HARE-chip (125 micron)
Authors:Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C.
Deposition date:2024-01-24
PDBID:8vso
Status:HPUB -- hold until publication
Title:Ternary structure of 14-3-3 sigma, BRAF phosphopeptide (pS365) and compound 78 (1124378)
Authors:Vickery, H.R., Virta, J.M., Pennings, M., Konstantinidou, M., van den Oetelaar, M., Neitz, R.J., Ottmann, C., Brunsveld, L., Arkin, M.R.
Deposition date:2024-01-24
PDBID:8vsl
Status:HPUB -- hold until publication
Title:Binary structure of 14-3-3 sigma and ARAF phosphopeptide (pS214)
Authors:Vickery, H.R., Virta, J.M., Pennings, M., Konstantinidou, M., van den Oetelaar, M., Neitz, R.J., Ottmann, C., Brunsveld, L., Arkin, M.R.
Deposition date:2024-01-24
PDBID:8vsm
Status:HPUB -- hold until publication
Title:Ternary structure of 14-3-3 sigma, ARAF phosphopeptide (pS214) and compound 78 (1124378)
Authors:Vickery, H.R., Virta, J.M., Pennings, M., Konstantinidou, M., van den Oetelaar, M., Neitz, R.J., Ottmann, C., Brunsveld, L., Arkin, M.R.
Deposition date:2024-01-24
PDBID:8vsn
Status:HPUB -- hold until publication
Title:Ternary structure of 14-3-3 sigma, ARAF phosphopeptide (pS214) and compound 79 (1124379)
Authors:Vickery, H.R., Virta, J.M., Pennings, M., Konstantinidou, M., van den Oetelaar, M., Neitz, R.J., Ottmann, C., Brunsveld, L., Arkin, M.R.
Deposition date:2024-01-24
PDBID:8rky
Status:HPUB -- hold until publication
Title:X-ray structure of the drug binding domain of AlbA in complex with the KMR-14-14 compound of the pyrrolobenzodiazepines class
Authors:Di Palma, M., Surani, Y.M., Rahman, K.M., Steiner, R.A.
Deposition date:2024-01-01
PDBID:8xi3
Status:HOLD -- hold until a certain date
Title:Structure of mouse SCMC-14-3-3gama complex
Authors:Chi, P., Han, Z., Jiao, H., Li, J., Wang, X., Hu, H., Deng, D.
Deposition date:2023-12-19
Release date:2024-12-19
PDBID:8rei
Status:HPUB -- hold until publication
Title:CTX-M-14 measured via serial crystallography from a silicon HARE-chip.
Authors:Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C.
Deposition date:2023-12-11
PDBID:8rem
Status:HPUB -- hold until publication
Title:CTX-M-14 measured via serial crystallography from a kapton HARE-chip (50 micron)
Authors:Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C.
Deposition date:2023-12-11
PDBID:8v78
Status:HPUB -- hold until publication
Title:Crystal structure of the core catalytic domain of human inositol phosphate multikinase in complex with compound 14
Authors:Wang, H., Shears, S.B.
Deposition date:2023-12-04
PDBID:8x6s
Status:AUTH -- processed, waiting for author review and approval
Title:FMDV (A/TUR/14/98) in complex with M688F
Authors:Li, H.Z., Dong, H., Liu, P.
Deposition date:2023-11-22
PDBID:8ul5
Status:AUTH -- processed, waiting for author review and approval
Title:Structure of rsKiiro using SSX after illumination with 14.43 mJ/mm^2 of 405 nm light
Authors:Baxter, J.M., van Thor, J.J.
Deposition date:2023-10-16
PDBID:8wrq
Status:HPUB -- hold until publication
Title:Cryo-EM structure of Cas12-1 with 14 nt complementary heteroduplex
Authors:Zhang, K., Zhang, X.
Deposition date:2023-10-16
PDBID:8ws6
Status:HOLD -- hold until a certain date
Title:Cryo-EM mini structure of Cas12-1 with 14 nt complementary heteroduplex
Authors:Kuo, Z., Xi, Z.
Deposition date:2023-10-16
Release date:2024-10-16
PDBID:8qs2
Status:HPUB -- hold until publication
Title:Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 29 (1076409)
Authors:Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R.
Deposition date:2023-10-10
Release date:2025-04-10
PDBID:8qs3
Status:HPUB -- hold until publication
Title:Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 23 (1083848)
Authors:Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R.
Deposition date:2023-10-10
Release date:2025-04-10
PDBID:8qs4
Status:HPUB -- hold until publication
Title:Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 22 (1083853)
Authors:Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R.
Deposition date:2023-10-10
Release date:2025-04-10
PDBID:8qs5
Status:HPUB -- hold until publication
Title:Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 21 (1075354)
Authors:Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R.
Deposition date:2023-10-10
Release date:2025-04-10
PDBID:8qs6
Status:HPUB -- hold until publication
Title:Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 21 (1075354)
Authors:Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R.
Deposition date:2023-10-10
Release date:2025-04-10
PDBID:8qs7
Status:HPUB -- hold until publication
Title:Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 70 (1084352)
Authors:Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R.
Deposition date:2023-10-10
Release date:2025-04-10
PDBID:8qs8
Status:HPUB -- hold until publication
Title:Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 78 (1084378)
Authors:Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R.
Deposition date:2023-10-10
Release date:2025-04-10
PDBID:8qs9
Status:HPUB -- hold until publication
Title:Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 83 (1084383)
Authors:Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R.
Deposition date:2023-10-10
Release date:2025-04-10

225158

數據於2024-09-18公開中

PDB statisticsPDBj update infoContact PDBjnumon