PDBID: | 7ili | Status: | HPUB -- hold until publication | Title: | Crystal structure of Human Neuronal Calcium Sensor 1 in complex with POB0029 | Authors: | Munoz-Reyes, D., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von Delft, F., Sanchez-Barrena, M.J. | Deposition date: | 2025-08-06 |
|
PDBID: | 7ilj | Status: | HPUB -- hold until publication | Title: | Crystal structure of Human Neuronal Calcium Sensor 1 in complex with POB0063 | Authors: | Munoz-Reyes, D., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von Delft, F., Sanchez-Barrena, M.J. | Deposition date: | 2025-08-06 |
|
PDBID: | 7ilk | Status: | HPUB -- hold until publication | Title: | Crystal structure of Human Neuronal Calcium Sensor 1 in complex with POB0101 | Authors: | Munoz-Reyes, D., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von Delft, F., Sanchez-Barrena, M.J. | Deposition date: | 2025-08-06 |
|
PDBID: | 7ill | Status: | HPUB -- hold until publication | Title: | Crystal structure of Human Neuronal Calcium Sensor 1 in complex with POB0164 | Authors: | Munoz-Reyes, D., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von Delft, F., Sanchez-Barrena, M.J. | Deposition date: | 2025-08-06 |
|
PDBID: | 9pxa | Status: | HPUB -- hold until publication | Title: | BG505/CH505wk4 Env chimeric SOSIP in complex with CH103 and RM19R Fabs | Authors: | Cottrell, C.A., Ozorowski, G., Wu, N.R., Ward, A.B. | Deposition date: | 2025-08-05 |
|
PDBID: | 9px9 | Status: | HPUB -- hold until publication | Title: | ATTR V122I cardiac amyloid fibrils | Authors: | Schaefer, J.H., Lander, G.C. | Deposition date: | 2025-08-05 |
|
PDBID: | 9pxe | Status: | HPUB -- hold until publication | Title: | JRFL.TD15 membrane Env liposome in complex with CH103.H17L8 Fab | Authors: | Karlinsey, D.C., Ozorowski, G., Ward, A.B. | Deposition date: | 2025-08-05 |
|
PDBID: | 9s8j | Status: | HPUB -- hold until publication | Title: | Structure of protein kinase CK2alpha mutant R191Q associated with the Okur-Chung Neurodevelopmental Syndrome | Authors: | Werner, C., Gast, A., Meyer, S.C., Jose, J., Niefind, K. | Deposition date: | 2025-08-05 |
|
PDBID: | 9s7u | Status: | HPUB -- hold until publication | Title: | X-ray structure of human glutamate carboxypeptidase II (GCPII) - the E424M inactive mutant, in complex with an inhibitor Ac-gamma-Glu-Dap(thiooxalyl)-OH | Authors: | Novakova, Z., Schenkmayerova, A., Motlova, L., Barinka, C. | Deposition date: | 2025-08-05 |
|
PDBID: | 9s7r | Status: | HPUB -- hold until publication | Title: | Structure of the de novo protein scaffold MID1sc9_4xE | Authors: | Klassen, R., Heider, A., Kugler, H., Groll, M., Zeymer, C. | Deposition date: | 2025-08-05 | Sequence: | >Entity 1 GGMGPLAQQIKNTLTFIGQANAAGRMDEVRTLQENLEPLWEEYFQQTEGSGGSPLAQQIEYGEVLIEQARAAGRMDEVRRLSENTLQLMKEYFQQSD
|
|
PDBID: | 9s76 | Status: | HPUB -- hold until publication | Title: | Structure of protein kinase CK2alpha mutant Y50C associated with the Okur-Chung Neurodevelopmental Syndrome | Authors: | Werner, C., Gast, A., Jose, J., Niefind, K. | Deposition date: | 2025-08-04 |
|
PDBID: | 9s77 | Status: | HPUB -- hold until publication | Title: | Structure of protein kinase CK2alpha mutant S51R associated with the Okur-Chung Neurodevelopmental Syndrome | Authors: | Werner, C., Gast, A., Jose, J., Niefind, K. | Deposition date: | 2025-08-04 |
|
PDBID: | 9s7a | Status: | HPUB -- hold until publication | Title: | Structure of protein kinase CK2alpha mutant R80C associated with the Okur-Chung Neurodevelopmental Syndrome | Authors: | Werner, C., Gast, A., Meyer, S.C., Jose, J., Niefind, K. | Deposition date: | 2025-08-04 |
|
PDBID: | 9s7h | Status: | HPUB -- hold until publication | Title: | Structure of protein kinase CK2alpha mutant H160R associated with the Okur-Chung Neurodevelopmental Syndrome | Authors: | Werner, C., Gast, A., Jose, J., Niefind, K. | Deposition date: | 2025-08-04 |
|
PDBID: | 9s7i | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of protein kinase CK2alpha mutant D175G associated with the Okur-Chung Neurodevelopmental Syndrome | Authors: | Werner, C., Gast, A., Jose, J., Niefind, K. | Deposition date: | 2025-08-04 |
|
PDBID: | 9pvo | Status: | HPUB -- hold until publication | Title: | Novel site 1 interaction of the IR/Ins-AC-S2 complex | Authors: | Vogel, A., Blakely, A., Hill, C.P. | Deposition date: | 2025-08-03 |
|
PDBID: | 9pvn | Status: | HPUB -- hold until publication | Title: | Human malic enzyme 3 complex with inhibitor NPD-389 at 1.82 Angstrom. | Authors: | Krinkel, B.A., Yosaatmadja, Y., Squire, C.J., Loomes, K.M. | Deposition date: | 2025-08-02 |
|
PDBID: | 9w5s | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of the LdcEt3 (P233C/L628C mutant)-PLP-thiaLys at pH 8.0, 0.3% Na[BF4] | Authors: | Huang, Y., Xing, Q., Huang, C.H., Lin, K.F., Chen, C.Y., Zhang, S. | Deposition date: | 2025-08-02 |
|
PDBID: | 9pvh | Status: | HPUB -- hold until publication | Title: | Human Cullin-4 in complex with CAND2 | Authors: | Kenny, S., Liu, X., Das, C. | Deposition date: | 2025-08-01 |
|
PDBID: | 9pva | Status: | HPUB -- hold until publication | Title: | 295-330 S320F tau | Authors: | Jayan, P., Dashnaw, C.M., Joachimiak, L.A. | Deposition date: | 2025-08-01 |
|
PDBID: | 9pve | Status: | HPUB -- hold until publication | Title: | HRAS complex with UM0152533 compound | Authors: | Jo, C., Lavoie, H., Therrien, M. | Deposition date: | 2025-08-01 |
|
PDBID: | 9pvf | Status: | HPUB -- hold until publication | Title: | KRAS complex with UM0152533 compound | Authors: | Jo, C., Lavoie, H., Therrien, M. | Deposition date: | 2025-08-01 |
|
PDBID: | 9w5a | Status: | HPUB -- hold until publication | Title: | The structure of dUTPase in complex with dUTP from Methanosarcina mazei | Authors: | Chen, S.C., Hsu, C.H. | Deposition date: | 2025-08-01 |
|
PDBID: | 9w5b | Status: | AUTH -- processed, waiting for author review and approval | Title: | cryo-EM structure of PSII D1-S264V from Thermosynechococcus vestitus BP-1 | Authors: | Fan, S.B., Jiang, H.W., Kato, K., Tsai, P.-C., Jia, A.Q., Nakajima, Y., Sugiura, M., Shen, J.-R. | Deposition date: | 2025-08-01 |
|
PDBID: | 9w5j | Status: | HPUB -- hold until publication | Title: | Pentamer Msp1 from S.cerevisiae (with a catalytic dead mutation) in complex with an unknown peptide substrate | Authors: | Chengdong, H., Simin, W., Xuan, C. | Deposition date: | 2025-08-01 |
|