| PDBID: | 9m07 | | Status: | HPUB -- hold until publication | | Title: | Histidine kinase QseE sensor domain of Salmonella Typhimurium SL1344 | | Authors: | Gao, X., Li, G.B., Gong, P.Q. | | Deposition date: | 2025-02-24 |
|
| PDBID: | 9lzv | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human glutaminyl cyclase in complex with Inhibitor M-42 | | Authors: | Li, G.-B., Meng, F.-B., Mou, J. | | Deposition date: | 2025-02-22 |
|
| PDBID: | 9ng1 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Crystal structure of FabG4 from Pseudomonas putida KT2440 | | Authors: | Andrzejewski, S.J., Friedman, A.J., Mains, K., Thompson, A., Sankaran, B., Zwart, P.H., Shirts, M.R., Fox, J.M. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9ne2 | | Status: | HPUB -- hold until publication | | Title: | cryoEM structure of the human OGA-L Catalytic Dimer | | Authors: | Nyenhuis, S.B., Steenackers, A., Hinshaw, J.E., Hanover, J.A. | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9ne4 | | Status: | HPUB -- hold until publication | | Title: | cryoEM structure of the A-chain of the human OGA-L Catalytic Dimer | | Authors: | Nyenhuis, S.B., Steenackers, A., Hinshaw, J.E., Hanover, J.A. | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9ne5 | | Status: | HPUB -- hold until publication | | Title: | cryoEM structure of the B-chain of the human OGA-L Catalytic Dimer | | Authors: | Nyenhuis, S.B., Steenackers, A., Hinshaw, J.E., Hanover, J.A. | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9ned | | Status: | HPUB -- hold until publication | | Title: | AcA-EI-shaker with free peptide conformation B | | Authors: | Tan, X., Swartz, K.J. | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9igb | | Status: | HPUB -- hold until publication | | Title: | Structure of human Bcl-xL in complex with small molecule inhibitor | | Authors: | Dokurno, P., Novak, T., Kotschy, A., Hubbard, R.E., Murray, J.B. | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9igh | | Status: | HPUB -- hold until publication | | Title: | Structure of human Bcl-xL in complex with small molecule inhibitor | | Authors: | Dokurno, P., Novak, T., Kotschy, A., Hubbard, R.E., Davidson, J., Murray, J.B. | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9ly6 | | Status: | HPUB -- hold until publication | | Title: | antibody 20G5 (Fab'')2 in complex with human B7-H3 | | Authors: | Li, B., Zhou, S., He, K. | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9ncs | | Status: | HPUB -- hold until publication | | Title: | RNase A in complex with Uridine Vanadate and decavanadates | | Authors: | Gutierrez, C.S., Lim, D.C., Silkenath, B., Kojasoy, V., Raines, R.T. | | Deposition date: | 2025-02-17 | | Sequence: | >Entity 1
KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV
|
|
| PDBID: | 9nd7 | | Status: | HPUB -- hold until publication | | Title: | [T:Ag+/Hg2+:T--(pH8-pH9.5; 75s)] Metal-mediated DNA base pair in tensegrity triangle grown at pH 8 and soaked in pH 9.5 for 75s | | Authors: | Lu, B., Vecchioni, S. | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9nd6 | | Status: | HPUB -- hold until publication | | Title: | [T:Ag+/Hg2+:T--(pH8-pH9.5; 50s)] Metal-mediated DNA base pair in tensegrity triangle grown at pH 8 and soaked in pH 9.5 Ag/Hg for 50s | | Authors: | Lu, B., Vecchioni, S. | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9nd8 | | Status: | HPUB -- hold until publication | | Title: | [T:Ag+/Hg2+:T--(pH8-pH9.5; 95s)] Metal-mediated DNA base pair in tensegrity triangle grown at pH 8 and soaked in pH 9.5 Ag/Hg for 95s | | Authors: | Lu, B., Vecchioni, S. | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9nd9 | | Status: | HPUB -- hold until publication | | Title: | [T:Ag+/Hg2+:T--(pH11-pH9.5; 5s)] Metal-mediated DNA base pair in tensegrity triangle grown at pH 8 and soaked in pH 9.5 Ag/Hg for 5s | | Authors: | Lu, B., Vecchioni, S. | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9nbr | | Status: | HPUB -- hold until publication | | Title: | DNA Ligase 1 with 3''deoxyribo-8oxoG:C nick | | Authors: | KanalElamparithi, B., Caglayan, M. | | Deposition date: | 2025-02-14 |
|
| PDBID: | 9nbg | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | H-1 Parvovirus VLP - Glycan [s(Lex)2] | | Authors: | Busuttil, K.B., Bennett, A.B., McKenna, R. | | Deposition date: | 2025-02-13 |
|
| PDBID: | 9nb3 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of quaternary complex of human phosphoribosylglycinamidine synthase with thioester intermediate bound (at glutaminase site) and AMPPNP and FGAR (at synthase site). | | Authors: | Sharma, N., French, J.B. | | Deposition date: | 2025-02-13 |
|
| PDBID: | 9lw0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cytochrome P450PL2 from Parvibaculum lavamentivorans DS-1 | | Authors: | Cui, H.B. | | Deposition date: | 2025-02-13 |
|
| PDBID: | 9nal | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of ternary complex of human phosphoribosylglycinamidine synthase with the intermediate (iminophosphate) and ADP bound at the synthase site. | | Authors: | Sharma, N., French, J.B. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9ibh | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Salmonella typhimurium polynucleotide phosphorylase in complex with recognition site of RNase E | | Authors: | Paris, G., Luisi, B.F. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9n9w | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of AMPPNP bound human phosphoribosylformylglycinamidine synthase | | Authors: | Sharma, N., French, J.B. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9iaj | | Status: | HPUB -- hold until publication | | Title: | Structure of cyclodipeptide synthase from Nocardia brasiliensis (Nbra-CDPS) in complex with RNA microhelices mimicking tRNA-Ala acceptor arm | | Authors: | Marouf, F.Z., Charbonnier, J.B., Fernandez Varela, P. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9iak | | Status: | HPUB -- hold until publication | | Title: | Structure of cyclodipeptide synthase from Nocardia brasiliensis (Nbra-CDPS) in complex with RNA microhelices mimicking tRNA-Glu acceptor arm | | Authors: | Marouf, F.Z., Charbonnier, J.B., Fernandez Varela, P. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9ial | | Status: | HPUB -- hold until publication | | Title: | Structure of cyclodipeptide synthase from Nocardia brasiliensis (Nbra-CDPS) in complex with RNA microhelices mimicking tRNA-Glu acceptor arm | | Authors: | Marouf, F.Z., Charbonnier, J.B., Fernandez Varela, P. | | Deposition date: | 2025-02-11 |
|
