Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9wxr
Status:HPUB -- hold until publication
Title:sensory rhodopsin I with its cognate transducer HtrI
Authors:Lim, G.Z., Lin, Y.E., Wu, Y.M., Chen, P.C., Fu, H.Y., Yang, C.S.
Deposition date:2025-09-25
PDBID:9srp
Status:HPUB -- hold until publication
Title:Structure of the Diels-Alderase ChlE3 in complex with cofactor FAD
Authors:Manzo-Ruiz, M.B., Back, C.R., Race, P.R.
Deposition date:2025-09-24
PDBID:9wx0
Status:HPUB -- hold until publication
Title:AcrX13 wedges into Cas3 by mimicking Cas8 to block Cascade recruitment
Authors:Hu, C.Y., Zhang, S.F., Ma, S.S.
Deposition date:2025-09-24
PDBID:9sr2
Status:HPUB -- hold until publication
Title:Catalytically active GH161A phosphorylase refined in C1
Authors:Cooper, N., Cioci, G., Ladeveze, S., Potocki-Veronese, G., Moulis, C.
Deposition date:2025-09-23
PDBID:9yd7
Status:HPUB -- hold until publication
Title:Complex of Dihydroorotase from M. jannaschii with Carbamoyl Aspartate
Authors:Vitali, J., Nix, J.C., Newman, H.E., Colaneri, M.J.
Deposition date:2025-09-22
PDBID:9wvk
Status:HPUB -- hold until publication
Title:Crystal structure of human NIPBL C-terminal domain
Authors:Gupta, S., Roy, S.
Deposition date:2025-09-20
PDBID:9sqb
Status:HOLD -- hold until a certain date
Title:D-stereospecific hydrolase I from Bacillus thuringiensis Berliner 1915 in complex with benzoyl-D-arginine
Authors:Simon, A.H., Parthier, C., Bordusa, F., Stubbs, M.T., Schoepfel, M.
Deposition date:2025-09-19
Release date:2026-09-19
PDBID:9wut
Status:HPUB -- hold until publication
Title:Structure of dimeric Tribolium castaneum (Tc) PINK1 L552R mutant in prime-activation conformation
Authors:Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Chen, C., Qin, X.H., Mi, L.Z., Liu, Z.
Deposition date:2025-09-19
PDBID:9wuu
Status:HPUB -- hold until publication
Title:Structure of dimeric autoinhibited Tribolium castaneum (Tc) PINK1 L552R mutant in complex with Ca2+
Authors:Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Chen, C., Qin, X.H., Mi, L.Z., LIu, Z.
Deposition date:2025-09-19
PDBID:9wuv
Status:HPUB -- hold until publication
Title:Structure of dimeric Tribolium castaneum (Tc) PINK1 L552R mutant in complex with Ca2+
Authors:Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Chen, C., Qin, X.H., Mi, L.Z., Liu, Z.
Deposition date:2025-09-19
PDBID:9wuw
Status:HPUB -- hold until publication
Title:Structure of dimeric phosphomimetic mutant of Tribolium castaneum (Tc) PINK1
Authors:Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Chen, C., Qin, X.H., Mi, L.Z., Liu, Z.
Deposition date:2025-09-19
PDBID:9wux
Status:AUTH -- processed, waiting for author review and approval
Title:Structure of the tetrameric trans-autophosphorylation complex of Tribolium castaneum (Tc) PINK1
Authors:Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Chen, C., Qin, X.H., Mi, L.Z., Liu, Z.
Deposition date:2025-09-19
PDBID:9wuy
Status:HPUB -- hold until publication
Title:Structure of dimeric autoinhibited Tribolium castaneum (Tc) PINK1 L552R mutant
Authors:Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Chen, C., Qin, X.H., Mi, L.Z., Liu, Z.
Deposition date:2025-09-19
PDBID:9wva
Status:HPUB -- hold until publication
Title:Crystal structure of the Y393A FMNH2-dependent monooxygenase
Authors:Lee, C., Kim, D., Ka, S., Park, S., Phan, H.T.L., Oh, J.
Deposition date:2025-09-19
PDBID:9wv8
Status:HPUB -- hold until publication
Title:Crystal structure of phosphate binding protein(PstS1) from Synechocystis sp. PCC 6803
Authors:Wang, C.Y., Lu, Y.P., Ma, H.L.
Deposition date:2025-09-19
PDBID:9yc7
Status:HPUB -- hold until publication
Title:Plasmodium falciparum M17 aminopeptidase (PfA-M17) bound to inhibitor 3k (MIPS3415)
Authors:Mansouri, M., McGowan, S., Webb, C.T.
Deposition date:2025-09-18
PDBID:9yc5
Status:HPUB -- hold until publication
Title:Human uPAR bound to the Fab fragment of targeted cancer therapeutic antibody FL1
Authors:Anane, R.F., Whisstock, J.C., Engelholm, L.H., Law, R.H.P., Ploug, M.
Deposition date:2025-09-18
PDBID:9yc6
Status:AUTH -- processed, waiting for author review and approval
Title:Mutant human uPAR bound to the Fab fragment of the targeted cancer therapeutic antibody FL1
Authors:Anane, R.F., Whisstock, J.C., Engelholm, L.H., Law, R.H.P., Ploug, M.
Deposition date:2025-09-18
PDBID:9wus
Status:HPUB -- hold until publication
Title:Cryo-EM Structure of the Periplasmic Domain of AAA Protease FtsH
Authors:Kabasakal, B.V., Goc, G., Yadav, S., Borucu, U., Berger, I., Schaffitzel, C.
Deposition date:2025-09-18
PDBID:9wuj
Status:HPUB -- hold until publication
Title:Diguanylate cyclase Q15Z91 complex with c-di-GMP and citrate
Authors:Han, L., Silvaggi, N.R.
Deposition date:2025-09-18
PDBID:9spl
Status:HOLD -- hold until a certain date
Title:D-stereospecific hydrolase I from Bacillus thuringiensis Berliner 1915
Authors:Schoepfel, M., Parthier, C., Bordusa, F., Stubbs, M.T., Simon, A.H.
Deposition date:2025-09-17
Release date:2026-09-17
PDBID:9yc0
Status:HPUB -- hold until publication
Title:Plasmodium falciparum M17 aminopeptidase (PfA-M17) bound to inhibitor 3ab (MIPS3413)
Authors:Mansouri, M., McGowan, S., Webb, C.T.
Deposition date:2025-09-17
PDBID:9ybo
Status:HPUB -- hold until publication
Title:Crystal structure of Trypanosoma cruzi cruzain in complex with boceprevir
Authors:Ferreira, P.R., Muniz, J.R.C.
Deposition date:2025-09-17
Sequence:

>Entity 1


APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG
PDBID:9wu2
Status:HPUB -- hold until publication
Title:Crystal structure of cZ22-Fab in complex with left-handed dC(GC)3 DNA
Authors:Lee, C.C., Hsu, S.F., Ko, T.P., Wang, A.H.J.
Deposition date:2025-09-17
PDBID:9spc
Status:HPUB -- hold until publication
Title:Recombinant human butyrylcholinesterase in complex with ethyl 1-[3-(2-oxopyrrolidin-1-yl)propyl]-2-phenyl-1H-1,3-benzodiazole-5-carboxylate
Authors:Brazzolotto, X., Ha, Z.Y., Law, C.S.W., Yeong, K.Y.
Deposition date:2025-09-16

245663

數據於2025-12-03公開中

PDB statisticsPDBj update infoContact PDBjnumon