| PDBID: | 9n90 | | Status: | HPUB -- hold until publication | | Title: | Cryo EM Structure of Full Length mGluR8 Bound to Agonist L-AP4, in the presence of PAM VU6005649 and Beta-Arrestin 1, class 1 | | Authors: | Marx, D.C., Levitz, J.T. | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9n91 | | Status: | HPUB -- hold until publication | | Title: | Cryo EM Structure of Full Length mGluR8 Bound to Agonist L-AP4, in the presence of PAM VU6005649 and Beta-Arrestin 1, class 2 | | Authors: | Marx, D.C., Levitz, J.T. | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9n9b | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of SARS-CoV-2 main protease V186F covalently bound to inhibitor GRL-051-22 at 1.60 A | | Authors: | Beechboard, S.N., Meadows, M.S., Ghosh, A.K., Mesecar, A.D., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2025-02-10 | | Sequence: | >Entity 1
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFFDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ
|
|
| PDBID: | 9iaa | | Status: | HPUB -- hold until publication | | Title: | DtpB in complex with photocaged nitric oxide, 1.24 s, 0.81 microjoule, SSX | | Authors: | Smyth, P., Williams, L.J., Hough, M.A., Worrall, J.A.R., Owen, R.L. | | Deposition date: | 2025-02-09 |
|
| PDBID: | 9ia9 | | Status: | HPUB -- hold until publication | | Title: | DtpB in complex with photocaged nitric oxide, 1.24 s, 8.05 microjoule, SSX | | Authors: | Smyth, P., Williams, L.J., Hough, M.A., Worrall, J.A.R., Owen, R.L. | | Deposition date: | 2025-02-08 |
|
| PDBID: | 9lu8 | | Status: | HOLD -- hold until a certain date | | Title: | Structure of yeast 1,3-beta-glucan synthase FKS2 | | Authors: | Xiang, W., Jialu, L. | | Deposition date: | 2025-02-08 | | Release date: | 2026-02-08 |
|
| PDBID: | 9n7n | | Status: | HPUB -- hold until publication | | Title: | Glutarate L-2-hydroxylase Q184C mutant-5''-Mal-C6-AGCT DNA conjugate at 1.82 Angstrom resolution | | Authors: | Han, Z., Mirkin, C.A. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9i92 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Shigella flexneri LptDE bound by a Bicyclic peptide molecule (Compound 1) | | Authors: | Allyjaun, S., Newman, H., Dunbar, E., Hardwick, S.W., Chirgadze, D.Y., van den Berg, B., Hubbard, J. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9n6f | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of SARS-CoV-2 main protease M165I covalently bound to inhibitor GRL-051-22 at 1.90 A | | Authors: | Beechboard, S.N., Meadows, M.S., Ghosh, A.K., Mesecar, A.D. | | Deposition date: | 2025-02-05 | | Sequence: | >Entity 1
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHIELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ
|
|
| PDBID: | 9n5c | | Status: | HPUB -- hold until publication | | Title: | RNA polymerase II elongation complex with 8-oxoG at +1 site, CMPCPP-bound | | Authors: | Oh, J., Wang, D. | | Deposition date: | 2025-02-04 |
|
| PDBID: | 9n5d | | Status: | HPUB -- hold until publication | | Title: | RNA polymerase II elongation complex with 8-oxoG at +1 site, CMP added | | Authors: | Oh, J., Wang, D. | | Deposition date: | 2025-02-04 |
|
| PDBID: | 9n5e | | Status: | HOLD -- hold until a certain date | | Title: | RNA polymerase II elongation complex with 8-oxoG at +1 site, AMPCPP in E-site | | Authors: | Oh, J., Wang, D. | | Deposition date: | 2025-02-04 | | Release date: | 2026-02-04 |
|
| PDBID: | 9n5g | | Status: | HPUB -- hold until publication | | Title: | RNA polymerase II elongation complex with 8-oxoG at +1 site, ATP in both A- and E-site | | Authors: | Oh, J., Wang, D. | | Deposition date: | 2025-02-04 |
|
| PDBID: | 9n5q | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of SARS-CoV-2 main protease M49I covalently bound to inhibitor GRL-051-22 at 1.50 A | | Authors: | Beechboard, S.N., Mesecar, A.D., Ghosh, A.K., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2025-02-04 | | Sequence: | >Entity 1
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDILNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ
|
|
| PDBID: | 9n5r | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of CCoV-HuPn-2018 main protease covalently bound to inhibitor GRL-170-21 at 1.89A | | Authors: | Jayashankar, U., Ghosh, A.K., Mesecar, A.D., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2025-02-04 | | Sequence: | >Entity 1
SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRVINYENEMSSVRLHNFSVSKNNVFLGVVSAKYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVSENATLYFVYMHHLELGNGSHVGSNLEGEMYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFTELSSTDAFSMLAAKTGQSVEKLLDSIVRLNKGFGGRTILSYGSLCDEFTPTEVIRQMYGVNLQ
|
|
| PDBID: | 9i84 | | Status: | HPUB -- hold until publication | | Title: | Structure of Mcl-1 complex with small molecule inhibitor | | Authors: | Dokurno, P., Murray, J.B., Rubbard, R.E. | | Deposition date: | 2025-02-04 |
|
| PDBID: | 9i85 | | Status: | HPUB -- hold until publication | | Title: | Structure of Mcl-1 complex with small molecule inhibitor | | Authors: | Dokurno, P., Murray, J.B., Rubbard, R.E. | | Deposition date: | 2025-02-04 |
|
| PDBID: | 9n47 | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Candida albicans pH regulated antigen 1 (Pra1) protein in the absence of Zn2+ | | Authors: | Syrjanen, J.L., Perera, R.L. | | Deposition date: | 2025-02-02 | | Release date: | 2026-02-02 |
|
| PDBID: | 9n4d | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Candida albicans pH regulated antigen 1 (Pra1) protein in complex with Zn2+ | | Authors: | Syrjanen, J.L., Perera, R.L. | | Deposition date: | 2025-02-02 | | Release date: | 2026-02-02 |
|
| PDBID: | 9i6y | | Status: | HPUB -- hold until publication | | Title: | 14-3-3sigma binding to the ERa peptide and compound 1 | | Authors: | Pennings, M.A.M., Arkin, M.R. | | Deposition date: | 2025-01-31 |
|
| PDBID: | 9i6g | | Status: | HPUB -- hold until publication | | Title: | DtpB in complex with photocaged nitric oxide, 1.24 s, 16.1 microjoule, SSX | | Authors: | Smyth, P., Williams, L.J., Hough, M.A., Worrall, J.A.R., Owen, R.L. | | Deposition date: | 2025-01-30 |
|
| PDBID: | 9i67 | | Status: | HPUB -- hold until publication | | Title: | StmPr1, Stenotrophomonas maltophilia Protease 1, 36 kDa alkine serine protease in complex with Chymostatin | | Authors: | Sommer, M., Outzen, L., Negm, A., Windhorst, S., Weber, W., Betzel, C. | | Deposition date: | 2025-01-29 | | Release date: | 2026-04-29 |
|
| PDBID: | 9i6c | | Status: | HPUB -- hold until publication | | Title: | StmPr1, Stenotrophomonas maltophilia Protease 1, 36 kDa alkine serine protease in complex with Leupeptin | | Authors: | Sommer, M., Outzen, L., Negm, A., Windhorst, S., Weber, W., Betzel, C. | | Deposition date: | 2025-01-29 | | Release date: | 2026-04-29 |
|
| PDBID: | 9lql | | Status: | HPUB -- hold until publication | | Title: | Structure of STG-hydrolyzing beta-glucosidase 1 (PSTG1) complexed with heptyl 1-thio-beta-D-glucopyranoside | | Authors: | Yanai, T., Arai, A., Takahashi, Y., Imaizumi, R., Takeshita, K., Matsuura, H., Sakai, N., Takahashi, S., Yamamoto, M., Kataoka, K., Nakayama, T., Yamashita, S. | | Deposition date: | 2025-01-28 |
|
| PDBID: | 9i54 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Dopamine 1 receptor:GaS complex bound to 24 | | Authors: | Clairfeuille, T. | | Deposition date: | 2025-01-27 |
|
