| PDBID: | 9ngs | | Status: | HPUB -- hold until publication | | Title: | ELIC with propylamine facing ECD inwards in liposomes with 2:1:1 POPC:POPE:POPG | | Authors: | Dalal, V., Cheng, W.W.L. | | Deposition date: | 2025-02-22 |
|
| PDBID: | 9ngq | | Status: | HPUB -- hold until publication | | Title: | ELIC state 1 with propylamine facing ECD outwards in liposomes with 2:1:1 POPC:POPE:POPG | | Authors: | Dalal, V., Cheng, W.W.L. | | Deposition date: | 2025-02-22 |
|
| PDBID: | 9ngg | | Status: | HPUB -- hold until publication | | Title: | ELIC facing ECD inwards in liposomes with 2:1:1 POPC:POPE:POPG | | Authors: | Dalal, V., Cheng, W.W.L. | | Deposition date: | 2025-02-22 |
|
| PDBID: | 9ngr | | Status: | HPUB -- hold until publication | | Title: | ELIC state 2 with propylamine facing ECD outwards in liposomes with 2:1:1 POPC:POPE:POPG | | Authors: | Dalal, V., Cheng, W.W.L. | | Deposition date: | 2025-02-22 |
|
| PDBID: | 9ngi | | Status: | HPUB -- hold until publication | | Title: | ELIC5 with propylamine facing ECD inwards in liposomes with 2:1:1 POPC:POPE:POPG | | Authors: | Dalal, V., Cheng, W.W.L. | | Deposition date: | 2025-02-22 |
|
| PDBID: | 9q86 | | Status: | HPUB -- hold until publication | | Title: | McCP in complex with photocaged nitric oxide, 1.44 s, 9.5 microjoule, SSX | | Authors: | Smyth, P., Williams, L.J., Hough, M.A., Worrall, J.A.R., Owen, R.L. | | Deposition date: | 2025-02-22 |
|
| PDBID: | 9lyt | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of Mucuna sempervirens Pathogenesis-related protein 1 | | Authors: | Zha, H.G., Fan, S.L. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9ngc | | Status: | HPUB -- hold until publication | | Title: | ELIC5 with propylamine facing ECD outwards in liposomes with 2:1:1 POPC:POPE:POPG | | Authors: | Dalal, V., Cheng, W.W.L. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9q82 | | Status: | HPUB -- hold until publication | | Title: | Recombinant spore-silk A-ENA-1 fibers | | Authors: | Sleutel, M., Sogues, A., Remaut, H. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9nf2 | | Status: | HPUB -- hold until publication | | Title: | KRAS G12D Mutant KRAS 1-169 at 298 K bound to MRTX-1133 and GMPPNP | | Authors: | Xu, M., Deck, S.L., Milano, S.K., Aplin, C., Cerione, R.A. | | Deposition date: | 2025-02-20 |
|
| PDBID: | 9igt | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Assembly intermediate of human mitochondrial ribosome small subunit bound to METTL15, RBFA, and mtIF2 (State M2.1) | | Authors: | Khawaja, A., Singh, V., Shiriaev, D.I., Rorbach, J. | | Deposition date: | 2025-02-20 |
|
| PDBID: | 9lxy | | Status: | HPUB -- hold until publication | | Title: | Escherichia coli Acetyl-coenzyme A Carboxylase Protomer Complex (Single Ring, conformer 1) | | Authors: | Ng, J.C.H., Wen, X.K., Leung, S.K.P., Wang, J.Z.K., Lau, W.C.Y. | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9neh | | Status: | HPUB -- hold until publication | | Title: | The 1.48 Angstrom crystal structure of galactose oxidase variant with genetically incorporated Cl2-Tyr495 | | Authors: | Liu, A., Li, J., Graciano, A. | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9ndr | | Status: | HPUB -- hold until publication | | Title: | The 1.22 Angstrom crystal structure of galactose oxidase variant with genetically incorporated F2-Tyr495 | | Authors: | Liu, A., Li, J., Graciano, A. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ndu | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Ferric Human ADO C18S/C239S Variant in Complex with Hydralazine at 1.98 Angstrom Resolution | | Authors: | Liu, A., Li, J., Duan, R. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ifu | | Status: | HPUB -- hold until publication | | Title: | FSP1 (tetrapod ancestor) bound to FAD and NAD+ and compound 1 | | Authors: | Cecchini, D., Mattevi, A. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9if6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human SUMO E1 with large unit cell parameters in the P1 21 1 space group. | | Authors: | Viloria, M., Francois, R.M.M., Didierjean, C. | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9nbr | | Status: | HPUB -- hold until publication | | Title: | DNA Ligase 1 with 3''deoxyribo-8oxoG:C nick | | Authors: | KanalElamparithi, B., Caglayan, M. | | Deposition date: | 2025-02-14 |
|
| PDBID: | 9nbw | | Status: | HPUB -- hold until publication | | Title: | Closed conformation of ArsA from L. ferriphilum in complex with MgATP and arsenite at 1.5 minute time point | | Authors: | Mahajan, S., Rees, D.C., Clemons, W.M. | | Deposition date: | 2025-02-14 |
|
| PDBID: | 9lwc | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of epinephrine bound mut-dopamine receptor 1-miniGs-Nb35 complex | | Authors: | Zhang, X., Gao, K., Liu, X. | | Deposition date: | 2025-02-14 |
|
| PDBID: | 9nbg | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | H-1 Parvovirus VLP - Glycan [s(Lex)2] | | Authors: | Busuttil, K.B., Bennett, A.B., McKenna, R. | | Deposition date: | 2025-02-13 |
|
| PDBID: | 9lw0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cytochrome P450PL2 from Parvibaculum lavamentivorans DS-1 | | Authors: | Cui, H.B. | | Deposition date: | 2025-02-13 |
|
| PDBID: | 9nad | | Status: | HPUB -- hold until publication | | Title: | Human GSTO1-1 complexed with C5-1 | | Authors: | Oakley, A.J. | | Deposition date: | 2025-02-11 | | Sequence: | >Entity 1
SGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
|
|
| PDBID: | 9ib1 | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM focus map of prefusion SARS-CoV-2 spike (RBDs: 1 up & 2 down) bound to RBD-targeting MO176-117 antibody | | Authors: | Schulte, T., Wallden, W., Andrell, J., Ohlin, M. | | Deposition date: | 2025-02-11 | | Release date: | 2026-02-11 |
|
| PDBID: | 9iap | | Status: | HPUB -- hold until publication | | Title: | Structure of 1 in complex with GDP-KRAS | | Authors: | Boettcher, J. | | Deposition date: | 2025-02-11 |
|
