| PDBID: | 9bkr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the Human TRIP12 WWE domain (isoform 2) in complex with ATP | | Authors: | Kimani, S., Dong, A., Li, Y., Arrowsmith, C.H., Edwards, A.M., Halabelian, L., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-04-29 |
|
| PDBID: | 9bl1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of heme-binding protein from Populus trichocarpa | | Authors: | Kumaran, D., Grosjean, N., Blaby, E.C. | | Deposition date: | 2024-04-29 |
|
| PDBID: | 9bl3 | | Status: | HPUB -- hold until publication | | Title: | KIR3DL1*114 in complex with HLA-B*57:03 presenting the AW10 peptide | | Authors: | Faoro, C., Rossjohn, J. | | Deposition date: | 2024-04-29 |
|
| PDBID: | 9f5h | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MGAT5 bump-and-hole mutant in complex with UDP and M592 | | Authors: | Liu, Y., Bineva-Todd, G., Meek, R., Mazo, L., Piniello, B., Moroz, O.V., Begum, N., Roustan, C., Tomita, S., Kjaer, S., Rovira, C., Davies, G.J., Schumann, B. | | Deposition date: | 2024-04-28 |
|
| PDBID: | 9f59 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Poliovirus type 2 (strain MEF-1) stabilised virus-like particle (PV2 SC6b) from a mammalian expression system. | | Authors: | Bahar, M.W., Porta, C., Fry, E.E., Stuart, D.I. | | Deposition date: | 2024-04-28 |
|
| PDBID: | 9bkh | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of RidA family protein PA5083 from Pseudomonas aeruginosa with Acetaldehyde bound | | Authors: | Zhou, D., Chen, L., Rose, J.P., Wang, B.C. | | Deposition date: | 2024-04-28 |
|
| PDBID: | 9bki | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Rid family protein ACIAD3089 from Acinetobacter baylyi in C2 space group | | Authors: | Zhou, D., Chen, L., Rose, J.P., Wang, B.C. | | Deposition date: | 2024-04-28 |
|
| PDBID: | 9f4c | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the C-terminal domain of CKAP5/chTOG | | Authors: | Pfuhl, M. | | Deposition date: | 2024-04-27 |
|
| PDBID: | 9bkd | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The structure of human Pdcd4 bound to the 40S small ribosomal subunit | | Authors: | Brito Querido, J., Sokabe, M., Diaz-Lopez, I., Gordiyenko, Y., Zuber, P., Albacete-Albacete, L., Ramakrishnan, V., S.Fraser, C. | | Deposition date: | 2024-04-27 |
|
| PDBID: | 9bkc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Rid family protein PFL1385 from Pseudomonas fluorescens | | Authors: | Zhou, D., Chen, L., Rose, J.P., Wang, B.C. | | Deposition date: | 2024-04-27 |
|
| PDBID: | 9bke | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | STRUCTURE OF 4-HYDROXYPHENYLACETATE 3-MONOOXYGENASE (HPAB), OXYGENASE COMPONENT FROM ESCHERICHIA COLI MUTANT XS6 WITH AMP BOUND | | Authors: | Zhou, D., Chen, L., Rose, J.P., Wang, B.C. | | Deposition date: | 2024-04-27 |
|
| PDBID: | 9f49 | | Status: | HOLD -- hold until a certain date | | Title: | Structure of the bacteriophage K gp155 C-terminal domain, seleno-methionine modified version | | Authors: | Pichel, A., van Raaij, M.J. | | Deposition date: | 2024-04-26 | | Release date: | 2024-06-21 | | Sequence: | >Entity 1
KDF(MSE)LIGHRGATGYTDEHTIKGYQ(MSE)ALDKGADYIELDLQLTKDNKLLC(MSE)HDSTIDRTTTGTGKVGD(MSE)TLSYIQTNFTSLNGEPIPSLDDVLNHFGTKVKYYIETKRPFDAN(MSE)DRELLTQLKAKGLIGIGSERFQVIIQSFARESLINIHNQFSNIPLAYLTSTFSESE(MSE)DDCLSYGFYAIAPKYTTITKELVDLAHSKGLKVHAWTVNTKEE(MSE)QSLIQ(MSE)GVDGFFTNYLDEYKKI
|
|
| PDBID: | 8zb7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human left ventricle ATM complex | | Authors: | Li, D.N., Zhao, Q.Y., Liu, C. | | Deposition date: | 2024-04-26 |
|
| PDBID: | 8zbm | | Status: | HPUB -- hold until publication | | Title: | RAT skeletal muscle ATM complex | | Authors: | Li, D.N., Zhao, Q.Y., Liu, C. | | Deposition date: | 2024-04-26 |
|
| PDBID: | 8zbk | | Status: | HPUB -- hold until publication | | Title: | Mouse left ventricle ATM complex | | Authors: | Li, D.N., Zhao, Q.Y., Liu, C. | | Deposition date: | 2024-04-26 |
|
| PDBID: | 8zbn | | Status: | HPUB -- hold until publication | | Title: | Mouse MYH6 R404Q left ventricle ATM complex | | Authors: | Li, D.N., Zhao, Q.Y., Liu, C. | | Deposition date: | 2024-04-26 |
|
| PDBID: | 9bjy | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of RidA family protein PA5083 from Pseudomonas aeruginosa with TMAO bound | | Authors: | Zhou, D., Chen, L., Rose, J.P., Wang, B.C. | | Deposition date: | 2024-04-26 |
|
| PDBID: | 9bk1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Endoribonuclease L-PSP family protein PSPTO0102 Sulfur SAD phased | | Authors: | Zhou, D., Chen, L., Rose, J.P., Wang, B.C. | | Deposition date: | 2024-04-26 |
|
| PDBID: | 9bk4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of RidA family protein PA5083 from Pseudomonas aeruginosa with pyruvic acid bound | | Authors: | Zhou, D., Chen, L., Rose, J.P., Wang, B.C. | | Deposition date: | 2024-04-26 |
|
| PDBID: | 9bk8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of RidA family protein PA5083 from Pseudomonas aeruginosa with 2-ketobutyric acid bound | | Authors: | Zhou, D., Chen, L., Rose, J.P., Wang, B.C. | | Deposition date: | 2024-04-26 |
|
| PDBID: | 9bk9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Rid family protein PA0814 from Pseudomonas aeruginosa | | Authors: | Zhou, D., Chen, L., Rose, J.P., Wang, B.C. | | Deposition date: | 2024-04-26 |
|
| PDBID: | 9bka | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Rid family protein PSPTO3006 | | Authors: | Zhou, D., Chen, L., Rose, J.P., Wang, B.C. | | Deposition date: | 2024-04-26 |
|
| PDBID: | 9bkb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Rid family protein ACIAD3089 from Acinetobacter baylyi | | Authors: | Zhou, D., Chen, L., Rose, J.P., Wang, B.C. | | Deposition date: | 2024-04-26 |
|
| PDBID: | 9f38 | | Status: | HPUB -- hold until publication | | Title: | BsmI (wild-type) crystallized with Ca2+ and cognate dsDNA | | Authors: | Sieskind, R., Missoury, S., Madru, C., Commenge, I., Niogret, G., Hollenstein, M., Rondelez, Y., Haouz, A., Sauguet, L., Legrand, P., Delarue, M. | | Deposition date: | 2024-04-25 |
|
| PDBID: | 9bjk | | Status: | HPUB -- hold until publication | | Title: | Inactive mu opioid receptor bound to Nb6, naloxone and NAM | | Authors: | O''Brien, E.S., Wang, H., Kaavya Krishna, K., Zhang, C., Kobilka, B.K. | | Deposition date: | 2024-04-25 |
|
