| PDBID: | 9slx | | Status: | HPUB -- hold until publication | | Title: | holo human GSTA1 in complex with dendrogenin A (bilary salt analogue, 3beta,5alpha-dihydroxy-6beta-[2-(1H-imidazol-4-yl)-ethylamino]-cholan-24-oic acid) | | Authors: | Ndikoum-Matip, G., Ayadi, S., Poirot, M., Nahoum, V., Maveyraud, L. | | Deposition date: | 2025-09-05 |
|
| PDBID: | 9sm4 | | Status: | HOLD -- hold until a certain date | | Title: | Zuzalysin active dodecahedral complex | | Authors: | Rodriguez-Banqueri, A., Madej, M., Eckhard, U., Koziej, L., Glatt, S., Potempa, J., Gomis Ruth, F.X. | | Deposition date: | 2025-09-05 | | Release date: | 2026-09-05 |
|
| PDBID: | 9sma | | Status: | HPUB -- hold until publication | | Title: | Structure and mechanism of the broad spectrum CRISPR-associated ring nuclease Crn4 | | Authors: | McMahon, S.A., Hoikkala, V., Gloster, T.M., White, M.F. | | Deposition date: | 2025-09-05 | | Sequence: | >Entity 1
MTSATPVTLVNLTPHEVILHLDGGPLRLPGADVVPRLLLSEGRQETLAVYDPERPGEAAVAREVPIAVGATWLGIDPPLPEPRPGTVYVTSRVVAEHFPERTDLVWPDDLIRDADGQVVGARRLGCLPRGDDDGAPGDLDERRRAEGER
|
|
| PDBID: | 9sm9 | | Status: | HPUB -- hold until publication | | Title: | Acoustofluidic Serial Crystallography - On, same number of indexed crystals as Off | | Authors: | Keloth, A., Kellermann, K.H., Henkel, A., Middendorf, P., Chapman, H.C. | | Deposition date: | 2025-09-05 |
|
| PDBID: | 9wnn | | Status: | HPUB -- hold until publication | | Title: | Human Pin1 (Peptidyl-prolyl cis-trans isomerase) catalytic domain in complex with a covalent inhibitor | | Authors: | Wang, X.Y., Zhang, D.P., Zhou, J., Xu, B.L. | | Deposition date: | 2025-09-04 |
|
| PDBID: | 9wn1 | | Status: | HPUB -- hold until publication | | Title: | PhospholipaseA2 with a ligand | | Authors: | Zhu, D., Wang, Q. | | Deposition date: | 2025-09-04 |
|
| PDBID: | 9y4x | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | 3-P35-J61 AGS-bound Dimeric Themotoga maritima UvrA bound to Damaged DNA with a 3 nucleotide gap | | Authors: | Semoy, D., Jeruzalmi, D., Milia, E., Hartley, S. | | Deposition date: | 2025-09-04 |
|
| PDBID: | 9y4y | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | 3-P35-J62_AGS-bound Dimeric Themotoga maritima UvrA bound to Damaged DNA with a 3 nucleotide gap | | Authors: | Semoy, D., Jeruzalmi, D., Milia, E., Hartley, S. | | Deposition date: | 2025-09-04 |
|
| PDBID: | 9y5c | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Protective antibody against gonococcal lipooligosaccharide bound to oligosaccharide antigen | | Authors: | Beernink, P.T., Silipo, A., Rice, P.A., Ram, S. | | Deposition date: | 2025-09-04 |
|
| PDBID: | 9y53 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Human Ornithine Aminotransferase Soaked with CPP115 | | Authors: | Corrigan, M.C., Vargas, A.L., Kang, K.M., Silverman, R.B., Liu, D. | | Deposition date: | 2025-09-04 |
|
| PDBID: | 9sli | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of human PIN1 covalently bound to Z154 | | Authors: | Igashov, I., Schneuing, A., Dobbelstein, A.W., Morozova, I., Neeser, R.M., Elizarova, E., Petruzzella, A., Gampp, O., Testori, F., Ferraris, D.M., Riek, R., Schwaller, P., Bronstein, M., Correia, B. | | Deposition date: | 2025-09-04 |
|
| PDBID: | 9slq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Trypanosome brucei enolase in complex with a camelid single-domain antibody | | Authors: | Sterckx, Y.G.-J. | | Deposition date: | 2025-09-04 |
|
| PDBID: | 9wmk | | Status: | HPUB -- hold until publication | | Title: | Noncognate Bicomponent HlgC:LukF-PV toxin from S. aureus | | Authors: | Das, P.P., Roy, A., Dutta, S. | | Deposition date: | 2025-09-03 |
|
| PDBID: | 9wmg | | Status: | HPUB -- hold until publication | | Title: | Structurally oriented stability promotion of anti-hapten nanobody: A unique strategy from mutagenesis of distal framework region. | | Authors: | Liang, C. | | Deposition date: | 2025-09-03 |
|
| PDBID: | 9y4p | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of DNMT3A2/3B3 in complex with H3K36me2 di-nucleosome with eight base pair linker | | Authors: | Xie, X., Zhou, X.E., Worden, E.J., Jones, P.A. | | Deposition date: | 2025-09-03 |
|
| PDBID: | 9y4t | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | V-shaped (channel-formed), ATP-bound, VX809-bound conformation of wild-type human CFTR (composite map from PHENIX based on consensus and local refinement maps from cryoSPARC) | | Authors: | Hunt, J.F., Paige, A.S., Baranwal, J., Cohen, B.M., Goldberg, P.M., Wang, C., Loughlin, B.J., Kappes, J.C., Yang, Z., Jiang, F., Govaerts, C., Overtus, M., Rich, Z. | | Deposition date: | 2025-09-03 |
|
| PDBID: | 9y4v | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a GH5_18 from Microbacterium oxydans DSM 20578 | | Authors: | Higgins, M.A. | | Deposition date: | 2025-09-03 |
|
| PDBID: | 9y4i | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | a lactam bond forming ligase, CdnB | | Authors: | Zhao, G.X., Bewley, C. | | Deposition date: | 2025-09-03 | | Release date: | 2026-09-03 |
|
| PDBID: | 9y4g | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of Tuco tuco Ribosome with E-tRNA and mRNA | | Authors: | Gutierrez-Vargas, C., De, S., Maji, S., Liu, Z., Nieb, M., Seluanov, A., Gorbunova, V., Frank, J. | | Deposition date: | 2025-09-03 |
|
| PDBID: | 9y4h | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Guinea pig Ribosome with P/E-tRNA and mRNA | | Authors: | Gutierrez-Vargas, C., De, S., Maji, S., Liu, Z., Nieb, M., Seluanov, A., Gorbunova, V., Frank, J. | | Deposition date: | 2025-09-03 |
|
| PDBID: | 9y4q | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the human DCAF1 WDR domain in complex with OICR-40102 | | Authors: | kimani, S., Dong, A., Li, Y., Seitova, A., Mamai, A., Al-awar, R., Ackloo, S., Arrowsmith, C.H., Edwards, A.M., Halabelian, L., Structural Genomics Consortium (SGC) | | Deposition date: | 2025-09-03 |
|
| PDBID: | 9wlt | | Status: | HPUB -- hold until publication | | Title: | Noncognate Bicomponent LukS-PV:HlgB toxin from S. aureus | | Authors: | Das, P.P., Roy, A., Dutta, S. | | Deposition date: | 2025-09-02 |
|
| PDBID: | 9y3m | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Crystal Structure of Human Ornithine Aminotransferase Pre-inactivated by CPP115 (Covalent Inactivation) | | Authors: | Vargas, A.L., Kang, K.M., Corrigan, M.C., Liu, D., Silverman, R.B. | | Deposition date: | 2025-09-02 |
|
| PDBID: | 9y3k | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Human Ornithine Aminotransferase Pre-Inactivated by CPP115 (Tight Binding) | | Authors: | Corrigan, M.C., Vargas, A.L., Kang, K.M., Silverman, R.B., Liu, D. | | Deposition date: | 2025-09-02 |
|
| PDBID: | 9y44 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of Naked Mole-Rat Ribosome with P/E tRNA and eEF2 | | Authors: | Gutierrez-Vargas, C., De, S., Maji, S., Liu, Z., Nieb, M., Seluanov, A., Gorbunova, V., Frank, J. | | Deposition date: | 2025-09-02 |
|
