| PDBID: | 9nyl | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-27 | | Sequence: | >Entity 1
EDDIEADHVGTYGISVYQSPGDIGQYTFEFDGDELFYVDLDKKETVWMLPEFGQLASFDPQGGLQNIAVVKHNLGVLTKRSNSTPATNEAPQATVFPKSPVLLGQPNTLICFVDNIFPPVINITWLRNSKSVADGVYETSFFVNRDYSFHKLSYLTFIPSDDDIYDCKVEHWGLEEPVLKHWEPEIPAPMSELTETVVCALGLSVGLVGIVVGTIFIIQGLRSGGTSRHPGPL
>Entity 2
THYKAPWGELATDGGGGSLVPRGSGGGGSSERHFVYQFMGECYFTNGTQRIRYVTRYIYNREEYVRYDSDVGEHRAVTELGRPDAEYWNSQPEILERTRAELDTVCRHNYEGPETHTSLRRLEQPNVVISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPRRGEVYTCHVEHPSLKSPITVEWRAQSESA
>Entity 3
EAAVTQSPRNKVTVTGGNVTLSCRQTNSHNYMYWYRQDTGHGLRLIHYSYGAGNLQIGDVPDGYKATRTTQEDFFLLLELASPSQTSLYFCASSDTRGEQYFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
>Entity 4
QQKVQQSPESLIVPEGGMASLNCTSSDRNVDYFWWYRQHSGKSPKMLMSIFSNGEKEEGRFTVHLNKASLHTSLHIRDSQPSDSALYLCAASRGGRALIFGTGTTVSVSPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESS
|
|
| PDBID: | 9qpk | | Status: | HPUB -- hold until publication | | Title: | E.coli TalB mutant E96Q, F178Y, R300E | | Authors: | Soderholm, A., Roos, A., Widersten, M. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qpg | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase in complex with Fe and IPN | | Authors: | Rabe, P., Schofield, C.J. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qph | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase in complex with Fe and IPN using tr-SFX | | Authors: | Rabe, P., Schofield, C.J., Stead, A. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qpi | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase in complex with Fe and ACV | | Authors: | Rabe, P., Schofield, C.J., Stead, A. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qpe | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qpj | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase in complex with Fe and IPN using tr-SSX | | Authors: | Rabe, P., Schofield, C.J., Stead, A. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qpp | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of human MATa2 in complex with MAT2B isoform v1 at 2.6 A resolution | | Authors: | Khaja, F., Antonyuk, S.V., Muench, S.P., Hasnain, S.S. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qpo | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of human MATa2 in complex with MATBv2 at 2.6 A resolution | | Authors: | Khaja, F., Antonyuk, S.V., Muench, S.P., Hasnain, S.S. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qpm | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qpn | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qpd | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qpf | | Status: | HPUB -- hold until publication | | Title: | Solution structure of Sox2 DBD | | Authors: | Orsetti, A., van Ingen, H. | | Deposition date: | 2025-03-27 | | Sequence: | >Entity 1
GSNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTL
|
|
| PDBID: | 9qpl | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with an inhibitor | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qon | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qop | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qp8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Diels Alderase Cyc15b | | Authors: | Yang, S., Kisa, D., Basle, A., Race, P.R. | | Deposition date: | 2025-03-26 | | Release date: | 2026-03-26 |
|
| PDBID: | 9u8f | | Status: | HPUB -- hold until publication | | Title: | The Cryo-EM Structure of Full-Length Extracellular Domain of NKp46 in Complex with OmniClic Fab and Two OmnidAb nanobodies. | | Authors: | Srivastava, D.B., Zeng, B., Rivera, G., Harriman, W. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9u8j | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9u8n | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9u8o | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9u8p | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9u8q | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9u8r | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of thiamine pyrophosphate (TPP)-dependent alpha-imino acid decarboxylase (AzcB and AzcC) from Streptomyces mobaraensis in complex with TTPP and 6-amino-4-oxo-4,5-dihydro-1,3,5-triazine-2-carboxylic acid. | | Authors: | Nakashima, Y., Tsunoda, T., Ogasawara, Y., Dairi, T., Morita, H. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9u8s | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of thiamine pyrophosphate (TPP)-dependent alpha-imino acid decarboxylase (AzcB and AzcC) from Streptomyces mobaraensis in complex with TPP and 5-azacytosine. | | Authors: | Nakashima, Y., Tsunoda, T., Ogasawara, Y., Dairi, T., Morita, H. | | Deposition date: | 2025-03-26 |
|
